PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AT3G27010.1

Common Name

ATTCP20, AT-TCP20, MOJ10.8, PCF1, TCP20

Organism

Arabidopsis thaliana

Taxonomic ID

3702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

TCP

Protein Properties

Length: 314aa MW: 33390.9 Da PI: 7.2565

Description

TCP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT3G27010.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	TCP	124.4	1.2e-38	73	154	3	85
TCP 3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssasns 85 +k+++++++hTkv+gR+RR+R++a+caar+F+L++eLG+++d++ti+WLlqqa+p+i+++tg+++++as+ a+s s++++ AT3G27010.1 73 PKRSSNKDRHTKVEGRGRRIRMPALCAARIFQLTRELGHKSDGETIQWLLQQAEPSIIAATGSGTIPASAL-ASSAATSNHHQ 154 6999****************************************************************776.23333333322 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF03634	2.4E-32	77	258	IPR005333	Transcription factor, TCP
PROSITE profile	PS51369	28.016	78	132	IPR017887	Transcription factor TCP subgroup

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0008361	Biological Process	regulation of cell size
GO:0009653	Biological Process	anatomical structure morphogenesis
GO:1900056	Biological Process	negative regulation of leaf senescence
GO:0005634	Cellular Component	nucleus
GO:0000987	Molecular Function	core promoter proximal region sequence-specific DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0005515	Molecular Function	protein binding

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0000230	anatomy	inflorescence meristem
PO:0000293	anatomy	guard cell
PO:0009005	anatomy	root
PO:0009009	anatomy	plant embryo
PO:0009025	anatomy	vascular leaf
PO:0009046	anatomy	flower
PO:0009047	anatomy	stem
PO:0001078	developmental stage	plant embryo cotyledonary stage
PO:0004507	developmental stage	plant embryo bilateral stage
PO:0007103	developmental stage	LP.10 ten leaves visible stage
PO:0007611	developmental stage	petal differentiation and expansion stage

Sequence ? help Back to Top
Protein Sequence Length: 314 aa Download sequence Send to blast
MDPKNLNRHQ VPNFLNPPPP PRNQGLVDDD AASAVVSDEN RKPTTEIKDF QIVVSASDKE 60 PNKKSQNQNQ LGPKRSSNKD RHTKVEGRGR RIRMPALCAA RIFQLTRELG HKSDGETIQW 120 LLQQAEPSII AATGSGTIPA SALASSAATS NHHQGGSLTA GLMISHDLDG GSSSSGRPLN 180 WGIGGGEGVS RSSLPTGLWP NVAGFGSGVP TTGLMSEGAG YRIGFPGFDF PGVGHMSFAS 240 ILGGNHNQMP GLELGLSQEG NVGVLNPQSF TQIYQQMGQA QAQAQGRVLH HMHHNHEEHQ 300 QESGEKDDSQ GSGR

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
At.25359	0.0	root

Expression -- Microarray ? help Back to Top
Source	ID	E-value
GEO	186510479	0.0
Genevisible	257788_at	0.0
Expression Atlas	AT3G27010	-
AtGenExpress	AT3G27010	-
ATTED-II	AT3G27010	-

Functional Description ? help Back to Top
Source	Description
TAIR	Belongs to a TCP protein transcription factor family. Members of this family contain a predicted basic-helix-loop-helix domain involved in DNA binding. Related to rice PCF1 and PCF2 genes. Binds to the GCCCR element of CYCB1;1. Involved in regulation of expression of cell cycle control and ribosomal protein genes.
UniProt	Transcription factor that binds to the site II motif (3'-TGGGCC/T-5') in the promoter of PCNA-2 and to 3'-GCCCG/A-5' elements in the promoters of cyclin CYCB1-1 and ribosomal protein genes. {ECO:0000269\|PubMed:12631321, ECO:0000269\|PubMed:16123132}.

Function -- GeneRIF ? help Back to Top
p33(TCP20), encoded by the Arabidopsis TCP20 gene, binds to the GCCCR element in the promoters of cyclin CYCB1;1 [TCP20] [PMID: 16123132] AtTCP20 is involved in cell division and growth coordination. [PMID: 19091878] This study provides evidence for a mechanism whereby the transcriptional regulators SAC51 and TCP20 antagonistically regulate the expression of four subgroup Ib bHLH genes. [PMID: 24549883] TCP20 plays a key role in the systemic signaling pathway that directs nitrate foraging by Arabidopsis roots [PMID: 25288754] Data show that binding of LWD1 and TEOSINTE BRANCHED 1-CYCLOIDEA-PCF20 (TCP20) and TCP22 to the TCP-binding site in the CIRCADIAN CLOCK ASSOCIATED1 (CCA1) promoter activates CCA1. [PMID: 27734958] TCP20 and NLP6/NLP7 transcription factors control plant responses to nitrate availability. [PMID: 28202720]

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00384	DAP	27203113	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT3G27010.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Interaction ? help Back to Top
Source	Intact With
BioGRID	AT3G47620, AT4G18170, AT4G18390, AT4G27330, AT5G08070, AT5G08330, AT5G51910, AT5G60970, AT1G30210, AT1G35560, AT1G52890, AT1G53230, AT1G58100, AT1G69690
IntAct	Search Q9LSD5

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT3G27010

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AB026649	0.0	AB026649.1 Arabidopsis thaliana genomic DNA, chromosome 3, P1 clone: MOJ10.
GenBank	AJ291749	0.0	AJ291749.1 Arabidopsis thaliana mRNA for putative transcription factor (PCF1 gene).
GenBank	AK118178	0.0	AK118178.1 Arabidopsis thaliana At3g27010 mRNA for unknown protein, complete cds, clone: RAFL19-49-P20.
GenBank	BT006043	0.0	BT006043.1 Arabidopsis thaliana clone U50934 unknown protein (At3g27010) mRNA, complete cds.
GenBank	CP002686	0.0	CP002686.1 Arabidopsis thaliana chromosome 3, complete sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_001327814.1	0.0	TEOSINTE BRANCHED 1, cycloidea, PCF (TCP)-domain family protein 20
Refseq	NP_189337.1	0.0	TEOSINTE BRANCHED 1, cycloidea, PCF (TCP)-domain family protein 20
Swissprot	Q9LSD5	0.0	TCP20_ARATH; Transcription factor TCP20
TrEMBL	A0A178VAT1	0.0	A0A178VAT1_ARATH; TCP20
STRING	AT3G27010.1	0.0	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM4050	27	59
Representative plant	OGRP922	14	59

Link Out ? help Back to Top
Phytozome	AT3G27010.1
Entrez Gene	822318
iHOP	AT3G27010
wikigenes	AT3G27010

Publications ? help Back to Top
Cubas P,Lauter N,Doebley J,Coen E The TCP domain: a motif found in proteins regulating plant growth and development. Plant J., 1999. 18(2): p. 215-22 [PMID:10363373] Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] Seki M, et al. Functional annotation of a full-length Arabidopsis cDNA collection. Science, 2002. 296(5565): p. 141-5 [PMID:11910074] Kosugi S,Ohashi Y DNA binding and dimerization specificity and potential targets for the TCP protein family. Plant J., 2002. 30(3): p. 337-48 [PMID:12000681] Trémousaygue D, et al. Internal telomeric repeats and 'TCP domain' protein-binding sites co-operate to regulate gene expression in Arabidopsis thaliana cycling cells. Plant J., 2003. 33(6): p. 957-66 [PMID:12631321] Yamada K, et al. Empirical analysis of transcriptional activity in the Arabidopsis genome. Science, 2003. 302(5646): p. 842-6 [PMID:14593172] Li C,Potuschak T,Colón-Carmona A,Gutiérrez RA,Doerner P Arabidopsis TCP20 links regulation of growth and cell division control pathways. Proc. Natl. Acad. Sci. U.S.A., 2005. 102(36): p. 12978-83 [PMID:16123132] Vergnolle C, et al. The cold-induced early activation of phospholipase C and D pathways determines the response of two distinct clusters of genes in Arabidopsis cell suspensions. Plant Physiol., 2005. 139(3): p. 1217-33 [PMID:16258011] Andersson-Gunner Biosynthesis of cellulose-enriched tension wood in Populus: global analysis of transcripts and metabolites identifies biochemical and developmental regulators in secondary wall biosynthesis. Plant J., 2006. 45(2): p. 144-65 [PMID:16367961] Aguilar-Martínez JA,Poza-Carrión C,Cubas P Arabidopsis BRANCHED1 acts as an integrator of branching signals within axillary buds. Plant Cell, 2007. 19(2): p. 458-72 [PMID:17307924] Ascencio-Ib Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection. Plant Physiol., 2008. 148(1): p. 436-54 [PMID:18650403] Hervé C, et al. In vivo interference with AtTCP20 function induces severe plant growth alterations and deregulates the expression of many genes important for development. Plant Physiol., 2009. 149(3): p. 1462-77 [PMID:19091878] Viola IL,Uberti Manassero NG,Ripoll R,Gonzalez DH The Arabidopsis class I TCP transcription factor AtTCP11 is a developmental regulator with distinct DNA-binding properties due to the presence of a threonine residue at position 15 of the TCP domain. Biochem. J., 2011. 435(1): p. 143-55 [PMID:21241251] Viola IL,Reinheimer R,Ripoll R,Manassero NG,Gonzalez DH Determinants of the DNA binding specificity of class I and class II TCP transcription factors. J. Biol. Chem., 2012. 287(1): p. 347-56 [PMID:22074922] Danisman S, et al. Arabidopsis class I and class II TCP transcription factors regulate jasmonic acid metabolism and leaf development antagonistically. Plant Physiol., 2012. 159(4): p. 1511-23 [PMID:22718775] Efroni I, et al. Regulation of leaf maturation by chromatin-mediated modulation of cytokinin responses. Dev. Cell, 2013. 24(4): p. 438-45 [PMID:23449474] Danisman S, et al. Analysis of functional redundancies within the Arabidopsis TCP transcription factor family. J. Exp. Bot., 2013. 64(18): p. 5673-85 [PMID:24129704] Andriankaja ME, et al. Transcriptional coordination between leaf cell differentiation and chloroplast development established by TCP20 and the subgroup Ib bHLH transcription factors. Plant Mol. Biol., 2014. 85(3): p. 233-45 [PMID:24549883] Kim SH, et al. The Arabidopsis immune adaptor SRFR1 interacts with TCP transcription factors that redundantly contribute to effector-triggered immunity. Plant J., 2014. 78(6): p. 978-89 [PMID:24689742] Davi Class I TCP-DELLA interactions in inflorescence shoot apex determine plant height. Curr. Biol., 2014. 24(16): p. 1923-8 [PMID:25127215] We Convergent targeting of a common host protein-network by pathogen effectors from three kingdoms of life. Cell Host Microbe, 2014. 16(3): p. 364-75 [PMID:25211078] Guan P, et al. Nitrate foraging by Arabidopsis roots is mediated by the transcription factor TCP20 through the systemic signaling pathway. Proc. Natl. Acad. Sci. U.S.A., 2014. 111(42): p. 15267-72 [PMID:25288754] Chen GH,Sun JY,Liu M,Liu J,Yang WC SPOROCYTELESS is a novel embryophyte-specific transcription repressor that interacts with TPL and TCP proteins in Arabidopsis. J Genet Genomics, 2014. 41(12): p. 617-25 [PMID:25527103] Wang X, et al. TCP transcription factors are critical for the coordinated regulation of isochorismate synthase 1 expression in Arabidopsis thaliana. Plant J., 2015. 82(1): p. 151-62 [PMID:25702611] Jin J, et al. An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors. Mol. Biol. Evol., 2015. 32(7): p. 1767-73 [PMID:25750178] Zhu P, et al. Arabidopsis small nucleolar RNA monitors the efficient pre-rRNA processing during ribosome biogenesis. Proc. Natl. Acad. Sci. U.S.A., 2016. 113(42): p. 11967-11972 [PMID:27708161] Wu JF, et al. LWD-TCP complex activates the morning gene CCA1 in Arabidopsis. Nat Commun, 2016. 7: p. 13181 [PMID:27734958] Guan P, et al. Interacting TCP and NLP transcription factors control plant responses to nitrate availability. Proc. Natl. Acad. Sci. U.S.A., 2017. 114(9): p. 2419-2424 [PMID:28202720] Guan P Dancing with Hormones: A Current Perspective of Nitrate Signaling and Regulation in Arabidopsis. Front Plant Sci, 2017. 8: p. 1697 [PMID:29033968] Zhang N, et al. MOS1 functions closely with TCP transcription factors to modulate immunity and cell cycle in Arabidopsis. Plant J., 2018. 93(1): p. 66-78 [PMID:29086441] Bresso EG,Chorostecki U,Rodriguez RE,Palatnik JF,Schommer C Spatial Control of Gene Expression by miR319-Regulated TCP Transcription Factors in Leaf Development. Plant Physiol., 2018. 176(2): p. 1694-1708 [PMID:29133375] Konishi N,Okubo T,Yamaya T,Hayakawa T,Minamisawa K Nitrate Supply-Dependent Shifts in Communities of Root-Associated Bacteria in Arabidopsis. Microbes Environ., 2017. 32(4): p. 314-323 [PMID:29187692] Kosugi S,Ohashi Y PCF1 and PCF2 specifically bind to cis elements in the rice proliferating cell nuclear antigen gene. Plant Cell, 1997. 9(9): p. 1607-19 [PMID:9338963]