PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Medtr4g485530.1 | ||||||||
Common Name | MTR_4g485530 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 194aa MW: 22063.3 Da PI: 10.3219 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 49.4 | 1e-15 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g WT++Ed++l+d+++++G +W+t ++ g+ R +k+c++rw +yl Medtr4g485530.1 14 KGTWTKQEDQKLIDYINKHGEVCWSTLPQAAGLLRHGKSCRLRWMNYL 61 799*****************99**********99************97 PP | |||||||
2 | Myb_DNA-binding | 50.2 | 5.9e-16 | 67 | 111 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg++ ++E+ l+++++++lG++ W++Ia +++ gRt++++k++w+++ Medtr4g485530.1 67 RGNFAEDEENLIIKLHALLGNR-WSLIAGRLP-GRTDNEVKNFWNSH 111 8999******************.*********.***********987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 14.557 | 9 | 61 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 4.39E-27 | 11 | 108 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 4.2E-12 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 9.2E-14 | 14 | 61 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.4E-21 | 15 | 68 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 4.83E-9 | 16 | 61 | No hit | No description |
PROSITE profile | PS51294 | 25.81 | 62 | 116 | IPR017930 | Myb domain |
SMART | SM00717 | 9.8E-15 | 66 | 114 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.5E-14 | 67 | 111 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 8.6E-26 | 69 | 117 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 3.13E-10 | 69 | 112 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 194 aa Download sequence Send to blast |
MRKPSCDIKL DKNKGTWTKQ EDQKLIDYIN KHGEVCWSTL PQAAGLLRHG KSCRLRWMNY 60 LRPDLKRGNF AEDEENLIIK LHALLGNRWS LIAGRLPGRT DNEVKNFWNS HIRKKLIKKG 120 IDPNNHGLNH KIPPLQNPIM SNSSKSFGLK DIISKNRTSK THVDNYGEVI SNAAKGKDDS 180 YAQLLDLNLD LSL* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 4e-29 | 13 | 116 | 26 | 128 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Widely expressed at low level. Highly expressed in siliques. Weakly expressed in seedlings, young and mature leaves, cauline leaves, stems, flower buds and roots. {ECO:0000269|PubMed:9839469}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription repressor involved in regulation of protection against UV. Mediates transcriptional repression of CYP73A5, the gene encoding trans-cinnamate 4-monooxygenase, thereby regulating the accumulation of the UV-protectant compound sinapoylmalate. {ECO:0000269|PubMed:11080161}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Medtr4g485530.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Down-regulated by exposure to UV-B light. {ECO:0000269|PubMed:11080161}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KT699108 | 1e-155 | KT699108.1 Trifolium repens MYB133 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020239347.1 | 1e-100 | transcription factor MYB3 | ||||
Swissprot | Q9SZP1 | 2e-68 | MYB4_ARATH; Transcription repressor MYB4 | ||||
TrEMBL | A0A072UMB8 | 1e-139 | A0A072UMB8_MEDTR; Myb transcription factor | ||||
STRING | GLYMA20G01610.2 | 2e-97 | (Glycine max) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF264 | 34 | 221 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G38620.1 | 9e-70 | myb domain protein 4 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Medtr4g485530.1 |
Entrez Gene | 25494446 |