PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Medtr4g100720.1

Common Name

MTR_4g100720

Organism

Medicago truncatula

Taxonomic ID

3880

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago

Family

MYB

Protein Properties

Length: 176aa MW: 20435 Da PI: 8.2173

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Medtr4g100720.1	genome	Mt	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	63.9	3e-20	15	62	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+WT+eEd++l+++++ +G + Wkt+a+ g++R++k+c++rw++yl Medtr4g100720.1 15 RGAWTQEEDQKLAQCIQIHGAKKWKTVANNSGLNRCGKSCRLRWLNYL 62 89********************************************97 PP
2	Myb_DNA-binding	53.9	4.1e-17	68	113	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+ + eE++l+++++k+lG++ W++Ia +++ gRt++++k++w+++l Medtr4g100720.1 68 RGNISDEEEDLIIRLHKLLGNR-WSLIAGRLP-GRTDNEIKNYWNSHL 113 7899****************.*****.**********986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	25.398	10	66	IPR017930	Myb domain
SuperFamily	SSF46689	5.86E-30	13	109	IPR009057	Homeodomain-like
SMART	SM00717	5.7E-16	14	64	IPR001005	SANT/Myb domain
Pfam	PF00249	5.2E-18	15	62	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	3.1E-24	16	69	IPR009057	Homeodomain-like
CDD	cd00167	4.16E-11	17	62	No hit	No description
SMART	SM00717	2.1E-14	67	115	IPR001005	SANT/Myb domain
PROSITE profile	PS51294	20.392	67	117	IPR017930	Myb domain
Pfam	PF00249	2.2E-15	68	113	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	1.5E-25	70	116	IPR009057	Homeodomain-like
CDD	cd00167	3.80E-11	72	113	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0009957	Biological Process	epidermal cell fate specification
GO:0010090	Biological Process	trichome morphogenesis
GO:0045892	Biological Process	negative regulation of transcription, DNA-templated
GO:0045893	Biological Process	positive regulation of transcription, DNA-templated
GO:0048481	Biological Process	plant ovule development
GO:0048629	Biological Process	trichome patterning
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 176 aa Download sequence Send to blast
MAPRKDGPTK ETMNRGAWTQ EEDQKLAQCI QIHGAKKWKT VANNSGLNRC GKSCRLRWLN 60 YLRPNIKRGN ISDEEEDLII RLHKLLGNRW SLIAGRLPGR TDNEIKNYWN SHLCKKASHI 120 EEKPENFHCT RNYNSISGSL DSDVIFNVNE FLDFPTEEPY VFDWVNKFLE IETNN*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1h8a_C	6e-29	13	117	25	128	MYB TRANSFORMING PROTEIN
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Controls the expression of genes involved in anthocyanin biosynthesis. Regulates the expression of at least 3 structural genes: chalcone synthase, dihydroflavonol reductase and flavonol O(3) glucosyltransferase. C1 acts as a trans-acting factor.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Medtr4g100720.1

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AB490776	1e-106	AB490776.1 Lotus japonicus LjPAP mRNA for R2R3-MYB transcription factor LjPAP, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_004508935.1	4e-99	transcription factor MYB114-like
Swissprot	P10290	3e-51	MYBC_MAIZE; Anthocyanin regulatory C1 protein
TrEMBL	G7JHR6	1e-128	G7JHR6_MEDTR; Myb transcription factor
STRING	AES90887	1e-128	(Medicago truncatula)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF2148	32	88

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G35550.1	1e-52	MYB family protein

Link Out ? help Back to Top
Phytozome	Medtr4g100720.1
Entrez Gene	11410463

Publications ? help Back to Top
Chen B,Wang X,Hu Y,Wang Y,Lin Z Ectopic expression of a c1-I allele from maize inhibits pigment formation in the flower of transgenic tobacco. Mol. Biotechnol., 2004. 26(3): p. 187-92 [PMID:15004287] Young ND, et al. The Medicago genome provides insight into the evolution of rhizobial symbioses. Nature, 2011. 480(7378): p. 520-4 [PMID:22089132] Paz-Ares J,Ghosal D,Saedler H Molecular analysis of the C1-I allele from Zea mays: a dominant mutant of the regulatory C1 locus. EMBO J., 1990. 9(2): p. 315-21 [PMID:2303027] Cone KC,Burr FA,Burr B Molecular analysis of the maize anthocyanin regulatory locus C1. Proc. Natl. Acad. Sci. U.S.A., 1986. 83(24): p. 9631-5 [PMID:3025847] Paz-Ares J,Ghosal D,Wienand U,Peterson PA,Saedler H The regulatory c1 locus of Zea mays encodes a protein with homology to myb proto-oncogene products and with structural similarities to transcriptional activators. EMBO J., 1987. 6(12): p. 3553-8 [PMID:3428265] Scheffler B, et al. Molecular analysis of C1 alleles in Zea mays defines regions involved in the expression of this regulatory gene. Mol. Gen. Genet., 1994. 242(1): p. 40-8 [PMID:7904044] Franken P,Schrell S,Peterson PA,Saedler H,Wienand U Molecular analysis of protein domain function encoded by the myb-homologous maize genes C1, Zm 1 and Zm 38. Plant J., 1994. 6(1): p. 21-30 [PMID:7920701] Singer T,Gierl A,Peterson PA Three new dominant C1 suppressor alleles in Zea mays. Genet. Res., 1998. 71(2): p. 127-32 [PMID:9717435]