PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Medtr4g083390.2 | ||||||||
Common Name | MTR_4g083390 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
|
||||||||
Family | B3 | ||||||||
Protein Properties | Length: 150aa MW: 16982.3 Da PI: 4.5965 | ||||||||
Description | B3 family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | B3 | 36.6 | 8.2e-12 | 47 | 105 | 37 | 96 |
EEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEE CS B3 37 tledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkv 96 t+ +g+sW ++++ ++k +++ + W++F+++n Lk gD +vF+l+++se+e v+kv Medtr4g083390.2 47 TILKYRGKSWGMTYNGQNKTKQF-DSVSWEKFAEDNYLKLGDACVFELMKNSEEEIVFKV 105 556789********766666665.5669*********************99999998886 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.40.330.10 | 4.4E-13 | 11 | 109 | IPR015300 | DNA-binding pseudobarrel domain |
SuperFamily | SSF101936 | 3.92E-12 | 12 | 109 | IPR015300 | DNA-binding pseudobarrel domain |
CDD | cd10017 | 1.97E-10 | 13 | 109 | No hit | No description |
SMART | SM01019 | 1.2E-4 | 15 | 111 | IPR003340 | B3 DNA binding domain |
Pfam | PF02362 | 1.3E-9 | 46 | 105 | IPR003340 | B3 DNA binding domain |
PROSITE profile | PS50863 | 10.602 | 47 | 111 | IPR003340 | B3 DNA binding domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 150 aa Download sequence Send to blast |
MQTGGIEPLT GEPYFHVVLS KTHLSTRYGM GPSSSICEEL PSKEVPTILK YRGKSWGMTY 60 NGQNKTKQFD SVSWEKFAED NYLKLGDACV FELMKNSEEE IVFKVQILRG EEEPILLSEF 120 PGTAEANLSW LEIHLPLWDC SRLQDTFVL* |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Mtr.5198 | 0.0 | flower| glandular trichome| leaf| root| seed |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Medtr4g083390.2 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC202467 | 1e-156 | AC202467.11 Medicago truncatula clone mth2-13m8, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_024637421.1 | 1e-108 | B3 domain-containing protein Os04g0386900 isoform X2 | ||||
TrEMBL | G7JHL4 | 1e-106 | G7JHL4_MEDTR; B3 DNA-binding domain protein | ||||
STRING | AES90030 | 1e-86 | (Medicago truncatula) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G33280.1 | 2e-06 | B3 family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Medtr4g083390.2 |
Entrez Gene | 11441927 |
Publications ? help Back to Top | |||
---|---|---|---|
|