PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Medtr3g104750.1 | ||||||||
Common Name | MTR_3g104750 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 165aa MW: 18739.4 Da PI: 4.8096 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 101 | 6.9e-32 | 103 | 161 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDg++WrKYG+K+vk+s++pr+YYrC+ gC+vkk+ver+ +dp++v++tYeg+H+h+ Medtr3g104750.1 103 LDDGFRWRKYGKKMVKNSPNPRNYYRCSADGCQVKKRVERDVDDPSYVITTYEGTHTHP 161 59********************************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 7.2E-34 | 88 | 162 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 1.44E-28 | 96 | 162 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 29.953 | 98 | 163 | IPR003657 | WRKY domain |
SMART | SM00774 | 2.7E-37 | 103 | 162 | IPR003657 | WRKY domain |
Pfam | PF03106 | 9.2E-26 | 104 | 161 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 165 aa Download sequence Send to blast |
MTDKNPISPN SPDSDFTNQW SLELSEYLKF DDDIWPDDDT EPFVSEHVPN RDIQQANEFV 60 GDFGGSGSQI DGSSSRGVSN EGEKKEIRDH KVAFKTKSEV EILDDGFRWR KYGKKMVKNS 120 PNPRNYYRCS ADGCQVKKRV ERDVDDPSYV ITTYEGTHTH PSSH* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 1e-25 | 93 | 160 | 7 | 74 | Probable WRKY transcription factor 4 |
2lex_A | 1e-25 | 93 | 160 | 7 | 74 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Medtr3g104750.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | CT967316 | 1e-123 | CT967316.8 M.truncatula DNA sequence from clone MTH2-189G21 on chromosome 3, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_003603180.2 | 1e-120 | probable WRKY transcription factor 50 | ||||
TrEMBL | G7J8C4 | 1e-118 | G7J8C4_MEDTR; WRKY family transcription factor | ||||
STRING | AES73431 | 1e-119 | (Medicago truncatula) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF1120 | 34 | 110 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G26170.1 | 6e-42 | WRKY DNA-binding protein 50 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Medtr3g104750.1 |
Entrez Gene | 11431843 |
Publications ? help Back to Top | |||
---|---|---|---|
|