PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Medtr3g102600.2

Common Name

MTR_3g102600

Organism

Medicago truncatula

Taxonomic ID

3880

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago

Family

ARR-B

Protein Properties

Length: 190aa MW: 21694.2 Da PI: 4.6089

Description

ARR-B family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Medtr3g102600.2	genome	Mt	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	G2-like	66.1	6.1e-21	134	183	3	53
G2-like 3 rlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkY 53 + +W+ eLH++F+e v+qL G +kA+Pk+i +lm+v+ +t+e+v+ HLQ + Medtr3g102600.2 134 QFVWSVELHRKFLETVNQL-GVDKAVPKKIFDLMNVENITREDVATHLQAF 183 678**************.***************************87 PP
2	Response_reg	80.6	5.1e-27	14	122	1	109
EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHT CS Response_reg 1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealka 92 vl vdD+p+ + ll+++l++ +y +v++++++ al++l+e+ +Dl++ + mp+mdGl+ll+ e++lp+i+++ahge e++ +a++ Medtr3g102600.2 14 VLAVDDDPTSLLLLETLLRSCQY-HVTTTSEAITALTMLQENIdmFDLVIAEVHMPDMDGLKLLELVGL-EMDLPVIMLSAHGETELVMKAISH 105 799******************.***********999899***************87754.558***************** PP TESEEEESS--HHHHHH CS Response_reg 93 GakdflsKpfdpeelvk 109 Ga+dfl Kp+ eel++ Medtr3g102600.2 106 GARDFLLKPVRLEELRN 122 *************97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:3.40.50.2300	2.7E-38	11	131	No hit	No description
SuperFamily	SSF52172	7.97E-35	11	134	IPR011006	CheY-like superfamily
SMART	SM00448	9.2E-29	12	124	IPR001789	Signal transduction response regulator, receiver domain
PROSITE profile	PS50110	41.486	13	128	IPR001789	Signal transduction response regulator, receiver domain
Pfam	PF00072	1.5E-23	14	123	IPR001789	Signal transduction response regulator, receiver domain
CDD	cd00156	3.26E-21	15	128	No hit	No description
SuperFamily	SSF46689	2.78E-15	131	186	IPR009057	Homeodomain-like
Gene3D	G3DSA:1.10.10.60	2.3E-19	132	183	IPR009057	Homeodomain-like
TIGRFAMs	TIGR01557	5.8E-19	134	185	IPR006447	Myb domain, plants

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0000160	Biological Process	phosphorelay signal transduction system
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 190 aa Download sequence Send to blast
MDDFSDRFPI GMRVLAVDDD PTSLLLLETL LRSCQYHVTT TSEAITALTM LQENIDMFDL 60 VIAEVHMPDM DGLKLLELVG LEMDLPVIML SAHGETELVM KAISHGARDF LLKPVRLEEL 120 RNIWQHVIRN KESQFVWSVE LHRKFLETVN QLGVDKAVPK KIFDLMNVEN ITREDVATHL 180 QAFFQSFTL*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1irz_A	1e-16	131	183	4	56	ARR10-B
Search in ModeBase

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Mtr.11681	0.0	root\| stem

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Detected in the whole plant. Predominantly expressed in roots and leaves. {ECO:0000269\|PubMed:15173562}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional activator that binds specifically to the DNA sequence 5'-[AG]GATT-3'. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. Could directly activate some type-A response regulators in response to cytokinins. {ECO:0000269\|PubMed:11574878}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Medtr3g102600.2

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	JQ647414	0.0	JQ647414.1 Medicago truncatula cultivar Jemalong A17 response regulator 1 (RR1) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_013461736.2	1e-121	uncharacterized protein LOC25489924
Swissprot	O49397	4e-76	ARR10_ARATH; Two-component response regulator ARR10
TrEMBL	A0A072V176	1e-135	A0A072V176_MEDTR; Putative response regulator and transcription factor RR-A-type family
STRING	AES83961	1e-129	(Medicago truncatula)
STRING	AES85610	1e-129	(Medicago truncatula)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G31920.1	1e-73	response regulator 10

Link Out ? help Back to Top
Phytozome	Medtr3g102600.2
Entrez Gene	25489925

Publications ? help Back to Top
Young ND, et al. The Medicago genome provides insight into the evolution of rhizobial symbioses. Nature, 2011. 480(7378): p. 520-4 [PMID:22089132] Hill K,Schaller GE Enhancing plant regeneration in tissue culture: a molecular approach through manipulation of cytokinin sensitivity. Plant Signal Behav, 2013. 8(10): p. doi: 10.4161/psb.25709 [PMID:23887495] Ramireddy E,Chang L,Schmülling T Cytokinin as a mediator for regulating root system architecture in response to environmental cues. Plant Signal Behav, 2014. 9(1): p. e27771 [PMID:24509549] Choi SH, et al. Gene duplication of type-B ARR transcription factors systematically extends transcriptional regulatory structures in Arabidopsis. Sci Rep, 2014. 4: p. 7197 [PMID:25425016] Cortleven A, et al. Cytokinin Regulates the Etioplast-Chloroplast Transition through the Two-Component Signaling System and Activation of Chloroplast-Related Genes. Plant Physiol., 2016. 172(1): p. 464-78 [PMID:27388681] Street IH, et al. Cytokinin acts through the auxin influx carrier AUX1 to regulate cell elongation in the root. Development, 2016. 143(21): p. 3982-3993 [PMID:27697901] Wang Y,Wu Y,Yu B,Yin Z,Xia Y EXTRA-LARGE G PROTEINs Interact with E3 Ligases PUB4 and PUB2 and Function in Cytokinin and Developmental Processes. Plant Physiol., 2017. 173(2): p. 1235-1246 [PMID:27986866] Zhang TQ, et al. A Two-Step Model for de Novo Activation of WUSCHEL during Plant Shoot Regeneration. Plant Cell, 2017. 29(5): p. 1073-1087 [PMID:28389585] Meng WJ, et al. Type-B ARABIDOPSIS RESPONSE REGULATORs Specify the Shoot Stem Cell Niche by Dual Regulation of WUSCHEL. Plant Cell, 2017. 29(6): p. 1357-1372 [PMID:28576846] Zubo YO, et al. Cytokinin induces genome-wide binding of the type-B response regulator ARR10 to regulate growth and development in Arabidopsis. Proc. Natl. Acad. Sci. U.S.A., 2017. 114(29): p. E5995-E6004 [PMID:28673986] Zhang F,May A,Irish VF Type-B ARABIDOPSIS RESPONSE REGULATORs Directly Activate WUSCHEL. Trends Plant Sci., 2017. 22(10): p. 815-817 [PMID:28886911] Rong XF, et al. Type-B ARRs Control Carpel Regeneration Through Mediating AGAMOUS Expression in Arabidopsis. Plant Cell Physiol., 2018. 59(4): p. 756-764 [PMID:29186581] Bustillo-Avendaño E, et al. Regulation of Hormonal Control, Cell Reprogramming, and Patterning during De Novo Root Organogenesis. Plant Physiol., 2018. 176(2): p. 1709-1727 [PMID:29233938]