PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Medtr1g086510.1 | ||||||||
Common Name | MTR_1g086510 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 266aa MW: 30327.9 Da PI: 7.2544 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 58.2 | 1.8e-18 | 23 | 70 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT eEd +lvd+++ +G g+W+t a+ g++R++k+c++rw++yl Medtr1g086510.1 23 KGPWTLEEDTILVDYITIHGEGHWNTLASSAGLRRSGKSCRLRWLNYL 70 79********************************************97 PP | |||||||
2 | Myb_DNA-binding | 49.4 | 1.1e-15 | 76 | 119 | 1 | 46 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 rg+ T +E+ l++d++ ++G++ W++Ia++++ gRt++++k++w++ Medtr1g086510.1 76 RGNITLQEQILILDLHSRWGNR-WSKIAQHLP-GRTDNEIKNYWRT 119 7899******************.*********.***********96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 5.9E-21 | 17 | 73 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 15.136 | 18 | 70 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 5.99E-30 | 20 | 117 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 2.0E-13 | 22 | 72 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 5.1E-15 | 23 | 70 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 2.65E-9 | 25 | 70 | No hit | No description |
PROSITE profile | PS51294 | 23.061 | 71 | 125 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 7.9E-22 | 74 | 123 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.3E-13 | 75 | 123 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 4.8E-14 | 76 | 119 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.64E-9 | 80 | 119 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009651 | Biological Process | response to salt stress | ||||
GO:0009737 | Biological Process | response to abscisic acid | ||||
GO:0009751 | Biological Process | response to salicylic acid | ||||
GO:0046686 | Biological Process | response to cadmium ion | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 266 aa Download sequence Send to blast |
MRGMDIKVQK GGSAKENETG VRKGPWTLEE DTILVDYITI HGEGHWNTLA SSAGLRRSGK 60 SCRLRWLNYL RPDLRRGNIT LQEQILILDL HSRWGNRWSK IAQHLPGRTD NEIKNYWRTR 120 VIKQAKQLKC DVNSKQFRDV LRHVWMPRLL EQIQPAPQFP DTNNPNGSHI LLHQNTLQSS 180 VSGISGISSD SSSVEFQVAS NSDQNDSSEL LGHEGSKLWS SFNNQQVSEQ EKSGACDGDS 240 LWNDENMWFL QQLYEDVEIK YNLLA* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 5e-22 | 23 | 117 | 27 | 120 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Mtr.9233 | 0.0 | flower| root| seed |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Highly expressed in leaves. Expressed in roots and shoots. Expressed at low levels in flowers. {ECO:0000269|PubMed:22301384}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor involved in abiotic stress responses. Plays a regulatory role in tolerance to salt, cold, and drought stresses. Regulates positively the expression of genes involved in proline synthesis and transport, and genes involved in reactive oxygen species (ROS) scavenging such as peroxidase, superoxide dismutase and catalase during salt stress. Transactivates stress-related genes, including LEA3, RAB16A and DREB2A during salt stress. {ECO:0000269|PubMed:22301384}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Medtr1g086510.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by salt, cold and osmotic stresses, and abscisic acid (ABA). Down-regulated by salicylic acid (SA). {ECO:0000269|PubMed:22301384}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | EF468488 | 0.0 | EF468488.1 Medicago truncatula MYB transcription factor MYB61 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_003591357.1 | 0.0 | transcription factor JAMYB | ||||
Swissprot | Q10MB4 | 1e-80 | MYB2_ORYSJ; Transcription factor MYB2 | ||||
TrEMBL | G7ICT7 | 0.0 | G7ICT7_MEDTR; Myb transcription factor | ||||
STRING | AES61608 | 0.0 | (Medicago truncatula) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF875 | 34 | 125 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G48000.1 | 1e-78 | myb domain protein 112 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Medtr1g086510.1 |
Entrez Gene | 11413842 |