PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | AT1G48000.1 | ||||||||
Common Name | AtMYB112, MYB112 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 243aa MW: 28291.9 Da PI: 8.8884 | ||||||||
Description | myb domain protein 112 | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 58 | 2.2e-18 | 34 | 81 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+WT eEd +lv ++ ++G g+W++ +r g++Rt+k+c++rw++yl AT1G48000.1 34 RGPWTVEEDMKLVSYISLHGEGRWNSLSRSAGLNRTGKSCRLRWLNYL 81 89********************************************97 PP | |||||||
2 | Myb_DNA-binding | 45.6 | 1.6e-14 | 87 | 130 | 1 | 46 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 rg + +E+ ++++++ ++G++ W++Ia++++ gRt++++k++w++ AT1G48000.1 87 RGDISLQEQFIILELHSRWGNR-WSKIAQHLP-GRTDNEIKNYWRT 130 5666889***************.*********.***********96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 23.491 | 29 | 85 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.5E-30 | 32 | 128 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 2.1E-15 | 33 | 83 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 9.5E-17 | 34 | 81 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.1E-21 | 35 | 88 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.02E-10 | 36 | 81 | No hit | No description |
SMART | SM00717 | 8.1E-13 | 86 | 134 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS51294 | 16.094 | 86 | 136 | IPR017930 | Myb domain |
Pfam | PF00249 | 2.9E-13 | 87 | 130 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.5E-21 | 89 | 134 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 6.64E-9 | 91 | 130 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006357 | Biological Process | regulation of transcription from RNA polymerase II promoter | ||||
GO:0009651 | Biological Process | response to salt stress | ||||
GO:0009737 | Biological Process | response to abscisic acid | ||||
GO:0009751 | Biological Process | response to salicylic acid | ||||
GO:0030154 | Biological Process | cell differentiation | ||||
GO:0046686 | Biological Process | response to cadmium ion | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0000981 | Molecular Function | RNA polymerase II transcription factor activity, sequence-specific DNA binding | ||||
GO:0001135 | Molecular Function | transcription factor activity, RNA polymerase II transcription factor recruiting | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0044212 | Molecular Function | transcription regulatory region DNA binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0000293 | anatomy | guard cell | ||||
PO:0009025 | anatomy | vascular leaf | ||||
PO:0009029 | anatomy | stamen | ||||
PO:0009030 | anatomy | carpel | ||||
PO:0009031 | anatomy | sepal | ||||
PO:0009047 | anatomy | stem | ||||
PO:0025281 | anatomy | pollen | ||||
PO:0007115 | developmental stage | LP.04 four leaves visible stage | ||||
PO:0007611 | developmental stage | petal differentiation and expansion stage | ||||
PO:0007616 | developmental stage | flowering stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 243 aa Download sequence Send to blast |
MNISRTEFAN CKTLINHKEE VEEVEKKMEI EIRRGPWTVE EDMKLVSYIS LHGEGRWNSL 60 SRSAGLNRTG KSCRLRWLNY LRPDIRRGDI SLQEQFIILE LHSRWGNRWS KIAQHLPGRT 120 DNEIKNYWRT RVQKHAKLLK CDVNSKQFKD TIKHLWMPRL IERIAATQSV QFTSNHYSPE 180 NSSVATATSS TSSSEAVRSS FYGGDQVEFG TLDHMTNGGY WFNGGDTFET LCSFDELNKW 240 LIQ |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 2e-25 | 25 | 134 | 18 | 126 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
At.16915 | 0.0 | leaf |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | E-value | ||||
GEO | 15375307 | 0.0 | ||||
Genevisible | 259618_at | 0.0 | ||||
Expression Atlas | AT1G48000 | - | ||||
AtGenExpress | AT1G48000 | - | ||||
ATTED-II | AT1G48000 | - |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Highly expressed in leaves. Expressed in roots and shoots. Expressed at low levels in flowers. {ECO:0000269|PubMed:22301384}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
TAIR | Encodes a putative transcription factor (MYB112). | |||||
UniProt | Transcription factor involved in abiotic stress responses. Plays a regulatory role in tolerance to salt, cold, and drought stresses. Regulates positively the expression of genes involved in proline synthesis and transport, and genes involved in reactive oxygen species (ROS) scavenging such as peroxidase, superoxide dismutase and catalase during salt stress. Transactivates stress-related genes, including LEA3, RAB16A and DREB2A during salt stress. {ECO:0000269|PubMed:22301384}. |
Function -- GeneRIF ? help Back to Top | ||||||
---|---|---|---|---|---|---|
|
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | AT1G48000.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by salt, cold and osmotic stresses, and abscisic acid (ABA). Down-regulated by salicylic acid (SA). {ECO:0000269|PubMed:22301384}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Regulation -- Hormone ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hormone | |||||
AHD | abscisic acid, salicylic acid |
Phenotype -- Mutation ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
T-DNA Express | AT1G48000 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK229083 | 0.0 | AK229083.1 Arabidopsis thaliana mRNA for putative transcription factor MYB112, complete cds, clone: RAFL16-36-L19. | |||
GenBank | AY519562 | 0.0 | AY519562.1 Arabidopsis thaliana MYB transcription factor (At1g48000) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_564519.1 | 0.0 | myb domain protein 112 | ||||
Swissprot | Q10MB4 | 5e-85 | MYB2_ORYSJ; Transcription factor MYB2 | ||||
TrEMBL | A0A178WKB2 | 0.0 | A0A178WKB2_ARATH; MYB112 | ||||
TrEMBL | Q94CJ3 | 0.0 | Q94CJ3_ARATH; MYB transcription factor | ||||
STRING | AT1G48000.1 | 0.0 | (Arabidopsis thaliana) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4 | 28 | 2646 | Representative plant | OGRP5 | 17 | 1784 |
Link Out ? help Back to Top | |
---|---|
Phytozome | AT1G48000.1 |
Entrez Gene | 841218 |
iHOP | AT1G48000 |
wikigenes | AT1G48000 |