PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Medtr1g083070.1

Common Name

MTR_1g083070, NF-YB11

Organism

Medicago truncatula

Taxonomic ID

3880

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago

Family

NF-YB

Protein Properties

Length: 128aa MW: 14464.3 Da PI: 7.4528

Description

NF-YB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Medtr1g083070.1	genome	Mt	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NF-YB	148.5	1.3e-46	4	95	3	94
NF-YB 3 eqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrele 94 e d+ lPianv+rimk+ lP nakisk++k+++qec++efisfvt+easdkc++e+rkt+ngdd++wal++lGf++y+e++ yl k+r++e Medtr1g083070.1 4 EGDKTLPIANVGRIMKQNLPPNAKISKESKQLMQECATEFISFVTGEASDKCHKENRKTVNGDDICWALCSLGFDNYAEAIGRYLYKFRQAE 95 789**************************************************************************************987 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.20.10	1.4E-45	3	118	IPR009072	Histone-fold
SuperFamily	SSF47113	2.33E-35	6	115	IPR009072	Histone-fold
Pfam	PF00808	3.3E-26	8	72	IPR003958	Transcription factor CBF/NF-Y/archaeal histone domain
PRINTS	PR00615	6.0E-17	36	54	No hit	No description
PROSITE pattern	PS00685	0	39	55	IPR003956	Transcription factor, NFYB/HAP3, conserved site
PRINTS	PR00615	6.0E-17	55	73	No hit	No description
PRINTS	PR00615	6.0E-17	74	92	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0043565	Molecular Function	sequence-specific DNA binding
GO:0046982	Molecular Function	protein heterodimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 128 aa Download sequence Send to blast
MNDEGDKTLP IANVGRIMKQ NLPPNAKISK ESKQLMQECA TEFISFVTGE ASDKCHKENR 60 KTVNGDDICW ALCSLGFDNY AEAIGRYLYK FRQAELIRIN QNKLHETAKD KFEEDATNPS 120 TKHSSHR*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
4g91_B	2e-39	4	93	3	92	Transcription factor HapC (Eurofung)
4g92_B	2e-39	4	93	3	92	Transcription factor HapC (Eurofung)
Search in ModeBase

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Mtr.26046	0.0	root

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Expressed in flowers, siliques and young rosettes. {ECO:0000269\|PubMed:11250072}.

Functional Description ? help Back to Top
Source	Description
UniProt	Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00133	DAP	Transfer from AT1G09030	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Medtr1g083070.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AC151426	0.0	AC151426.32 Medicago truncatula clone mth2-6o22, complete sequence.
GenBank	AC161241	0.0	AC161241.18 Medicago truncatula clone mth2-193c3, complete sequence.
GenBank	JQ918284	0.0	JQ918284.1 Medicago truncatula nuclear transcription factor Y subunit B11 (NF-YB11) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_003591124.1	7e-93	nuclear transcription factor Y subunit B-4
Swissprot	O04027	1e-50	NFYB4_ARATH; Nuclear transcription factor Y subunit B-4
TrEMBL	G7I854	2e-91	G7I854_MEDTR; Nuclear transcription factor Y protein
STRING	AES61375	3e-92	(Medicago truncatula)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF805	32	131

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G09030.1	4e-53	nuclear factor Y, subunit B4

Link Out ? help Back to Top
Phytozome	Medtr1g083070.1
Entrez Gene	11410051

Publications ? help Back to Top
Young ND, et al. The Medicago genome provides insight into the evolution of rhizobial symbioses. Nature, 2011. 480(7378): p. 520-4 [PMID:22089132] Zhao H, et al. The Arabidopsis thaliana Nuclear Factor Y Transcription Factors. Front Plant Sci, 2016. 7: p. 2045 [PMID:28119722]