PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Medtr1g043080.1 | ||||||||
Common Name | MTR_1g043080 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 256aa MW: 29233.6 Da PI: 5.684 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 54.6 | 2.4e-17 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT eEde+l +++++G +W++ +++ g+ R++k+c++rw +yl Medtr1g043080.1 14 KGPWTLEEDEILTSYINKHGHSNWRALPKHAGLLRCGKSCRLRWINYL 61 79******************************99************97 PP | |||||||
2 | Myb_DNA-binding | 52 | 1.6e-16 | 67 | 112 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg++T eE+e +++ ++ lG++ W++Ia++++ gRt++++k+ w+++l Medtr1g043080.1 67 RGNFTNEEEETIIKMHESLGNR-WSAIAAKLP-GRTDNEIKNVWHTHL 112 89********************.*********.************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 1.6E-25 | 5 | 64 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 15.967 | 9 | 61 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 3.63E-30 | 11 | 108 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 2.6E-14 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.4E-15 | 14 | 61 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.30E-10 | 16 | 61 | No hit | No description |
PROSITE profile | PS51294 | 25.113 | 62 | 116 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 2.1E-26 | 65 | 116 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.1E-14 | 66 | 114 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 6.7E-15 | 67 | 112 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 2.21E-10 | 69 | 112 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 256 aa Download sequence Send to blast |
MVRAPCCEKK GLKKGPWTLE EDEILTSYIN KHGHSNWRAL PKHAGLLRCG KSCRLRWINY 60 LKPDIKRGNF TNEEEETIIK MHESLGNRWS AIAAKLPGRT DNEIKNVWHT HLKKRLLNTN 120 NNQPNSNTKK RVSKQKIKRS DSNSSTLTTA SNCTFSSDFS SQEKNLDNSI ICEDSLVTMP 180 EIDESFWSET VIDDEISSTM PSNSMTVSND LPDQQCIFNN SVENFQNPFD NDDDGMDFWY 240 DVFIKSGEST ELPEF* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 6e-27 | 12 | 116 | 5 | 108 | B-MYB |
1h8a_C | 8e-27 | 12 | 116 | 25 | 128 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Mtr.9245 | 0.0 | leaf| pod| root |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in roots, leaves, stems and flowers (PubMed:17015446, PubMed:19161942). Expressed in stomatal guard cells (PubMed:19161942). {ECO:0000269|PubMed:17015446, ECO:0000269|PubMed:19161942}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor involved in cold-regulation of CBF genes and in the development of freezing tolerance. May be part of a complex network of transcription factors controlling the expression of CBF genes and other genes in response to cold stress. Binds to the MYB recognition sequences in the promoters of CBF1, CBF2 and CBF3 genes (PubMed:17015446). Involved in drought and salt tolerance. May enhance expression levels of genes involved in abscisic acid (ABA) biosynthesis and signaling, as well as those encoding stress-protective proteins (PubMed:19161942). {ECO:0000269|PubMed:17015446, ECO:0000269|PubMed:19161942}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Medtr1g043080.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by abscisic acid (ABA) and drought stress (PubMed:19161942). Induced by salt stress (PubMed:19161942). {ECO:0000269|PubMed:19161942}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT051911 | 0.0 | BT051911.1 Medicago truncatula clone MTYF5_F6_F7_F81G-A-23 unknown mRNA. | |||
GenBank | BT139626 | 0.0 | BT139626.1 Medicago truncatula clone JCVI-FLMt-16F3 unknown mRNA. | |||
GenBank | BT146073 | 0.0 | BT146073.1 Medicago truncatula clone JCVI-FLMt-11D3 unknown mRNA. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_003590028.1 | 0.0 | transcription factor MYB14 | ||||
Swissprot | Q9LTC4 | 3e-83 | MYB15_ARATH; Transcription factor MYB15 | ||||
TrEMBL | G7I4Q3 | 0.0 | G7I4Q3_MEDTR; Myb-related transcription factor LBM1 | ||||
STRING | AES60279 | 0.0 | (Medicago truncatula) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF31 | 34 | 817 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G23250.1 | 2e-83 | myb domain protein 15 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Medtr1g043080.1 |
Entrez Gene | 11425175 |