PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 53433
Common NameMICPUCDRAFT_53433
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; prasinophytes; Mamiellophyceae; Mamiellales; Mamiellaceae; Micromonas; Micromonas pusilla
Family Nin-like
Protein Properties Length: 733aa    MW: 76335.9 Da    PI: 5.386
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
53433genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK78.85.9e-25179228352
  RWP-RK   3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
             +ei++e+ls++F+lp ++A+++Lg++lTvLKr+CR++GIkRWP+Rk+ksl
   53433 179 SEITQEELSSCFHLPSEAACRKLGIGLTVLKRQCRRFGIKRWPFRKMKSL 228
             78**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151918.019164248IPR003035RWP-RK domain
PfamPF020424.9E-19181228IPR003035RWP-RK domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0051302Biological Processregulation of cell division
Sequence ? help Back to Top
Protein Sequence    Length: 733 aa     Download sequence    Send to blast
MSANATDLAT APAAAGDPAA PSREGKTPEE GQQAASNDDD ARVKRESNDV NGISDQPPAA  60
EDDAVPAATT PKVGFSVEIV RSDPNADANA DAANAPEGAQ RDRQNSAFST GTTIDHAHDA  120
APPTNEEFED EGEDMMDDGG EDVMDGGDEY ERLLAAADVG GGDGAEKKPA KRRALRSASE  180
ITQEELSSCF HLPSEAACRK LGIGLTVLKR QCRRFGIKRW PFRKMKSLDR LITNVQAGIS  240
PGDQNRTLVK SVEELEEQKR RMEECQVLDL DDNTKRLQQA YSKANHKARR AAAAPEMNGV  300
GGLLALTGGG APSPPPEKKP PRAKKARNQP TSDAVNDSLE AAKAQARLLQ GVAATLPSLL  360
PGGIGDLDSH AVAAAVAAAA AAMSQHAAAP PPVNFAASGG LAAALAAREE KLPPHLRQKG  420
DWVGASVAAA AAAAAAGGRK SQQTVLEAAN PFPPRETTTT PRANDDVSVP VSGAWSPARP  480
ASRQHGEEEE DVEIEAILAR ANAGTTAIKQ EESSGEESES ESEPEPEEEE EVLLPDSRTG  540
RKRKMNPKFK DPKEEKKKKR KKKKKKPPVD ELESLAAAAL AGGLAGKGGR GGRGGRGRGG  600
GRGSRPSGET RGGRITLAAA LAKADALAAR AAAGLRPPQL PEEHPGFAPS QRSRYEAPPA  660
PPPEFGLAGL ALVEPAAPTI DKSAITSLVT EHADRLREVM TRAGVDAQTV AEAIGGEALK  720
LRDALDALLL PA*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1541563KRKMNPKFKDPKEEKKKKRKKKK
2551560PKEEKKKKRK
3554566EKKKKRKKKKKKP
4555560KKKKRK
5555562KKKKRKKK
6557561KKRKK
7557565KKRKKKKKK
8559565RKKKKKK
9592602RGGRGRGGGRG
10593600GGRGRGGG
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003063787.10.0predicted protein
TrEMBLC1N6T40.0C1N6T4_MICPC; Predicted protein
STRINGXP_003063787.10.0(Micromonas pusilla)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP841650
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18790.13e-18RWP-RK domain-containing protein
Publications ? help Back to Top
  1. Worden AZ, et al.
    Green evolution and dynamic adaptations revealed by genomes of the marine picoeukaryotes Micromonas.
    Science, 2009. 324(5924): p. 268-72
    [PMID:19359590]