PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Migut.O00781.1.p | ||||||||
Common Name | MIMGU_mgv1a019611mg | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 90aa MW: 10234.7 Da PI: 9.9431 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 50.5 | 4.9e-16 | 15 | 62 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+W eEde+l+++++ G g+W++ + g++R++k+c++rw +yl Migut.O00781.1.p 15 RGKWEVEEDEKLINYINANGEGSWRSLPTNAGLKRCGKSCRLRWINYL 62 89********************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 1.1E-19 | 7 | 63 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 21.963 | 10 | 66 | IPR017930 | Myb domain |
SMART | SM00717 | 8.8E-11 | 14 | 64 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.3E-14 | 15 | 62 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 7.59E-20 | 16 | 89 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.20E-7 | 17 | 62 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 4.0E-8 | 64 | 89 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 90 aa Download sequence Send to blast |
MGRKACCDKS ETLKRGKWEV EEDEKLINYI NANGEGSWRS LPTNAGLKRC GKSCRLRWIN 60 YLKSGLKRGS FTPHEDETIV KFHNTFGNK* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Flavonol-specific transcription activator involved in the regulation of several genes of flavonoid biosynthesis. Activates the expression of CHS, CHI, F3H and FLS1. Controls flavonol biosynthesis mainly in the root (PubMed:17419845, PubMed:20731781). Confers tolerance to UV-B (PubMed:19895401). {ECO:0000269|PubMed:15923334, ECO:0000269|PubMed:17419845, ECO:0000269|PubMed:19895401, ECO:0000269|PubMed:20731781}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Migut.O00781.1.p |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By nitrogen deficiency, sucrose and UV LIGHT (PubMed:17053893, PubMed:9839469). Triggered by HY5 in response to light and UV-B (PubMed:19895401). {ECO:0000269|PubMed:17053893, ECO:0000269|PubMed:19895401, ECO:0000269|PubMed:9839469}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012828161.1 | 3e-59 | PREDICTED: myb-related protein 308-like | ||||
Swissprot | O22264 | 9e-38 | MYB12_ARATH; Transcription factor MYB12 | ||||
TrEMBL | A0A022RVL4 | 7e-58 | A0A022RVL4_ERYGU; Uncharacterized protein (Fragment) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA12 | 24 | 2154 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G47460.1 | 4e-40 | myb domain protein 12 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Migut.O00781.1.p |