PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.O00781.1.p
Common NameMIMGU_mgv1a019611mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family MYB_related
Protein Properties Length: 90aa    MW: 10234.7 Da    PI: 9.9431
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.O00781.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.54.9e-161562148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      rg+W  eEde+l+++++  G g+W++ +   g++R++k+c++rw +yl
  Migut.O00781.1.p 15 RGKWEVEEDEKLINYINANGEGSWRSLPTNAGLKRCGKSCRLRWINYL 62
                      89********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.1E-19763IPR009057Homeodomain-like
PROSITE profilePS5129421.9631066IPR017930Myb domain
SMARTSM007178.8E-111464IPR001005SANT/Myb domain
PfamPF002491.3E-141562IPR001005SANT/Myb domain
SuperFamilySSF466897.59E-201689IPR009057Homeodomain-like
CDDcd001671.20E-71762No hitNo description
Gene3DG3DSA:1.10.10.604.0E-86489IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 90 aa     Download sequence    Send to blast
MGRKACCDKS ETLKRGKWEV EEDEKLINYI NANGEGSWRS LPTNAGLKRC GKSCRLRWIN  60
YLKSGLKRGS FTPHEDETIV KFHNTFGNK*
Functional Description ? help Back to Top
Source Description
UniProtFlavonol-specific transcription activator involved in the regulation of several genes of flavonoid biosynthesis. Activates the expression of CHS, CHI, F3H and FLS1. Controls flavonol biosynthesis mainly in the root (PubMed:17419845, PubMed:20731781). Confers tolerance to UV-B (PubMed:19895401). {ECO:0000269|PubMed:15923334, ECO:0000269|PubMed:17419845, ECO:0000269|PubMed:19895401, ECO:0000269|PubMed:20731781}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapMigut.O00781.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By nitrogen deficiency, sucrose and UV LIGHT (PubMed:17053893, PubMed:9839469). Triggered by HY5 in response to light and UV-B (PubMed:19895401). {ECO:0000269|PubMed:17053893, ECO:0000269|PubMed:19895401, ECO:0000269|PubMed:9839469}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012828161.13e-59PREDICTED: myb-related protein 308-like
SwissprotO222649e-38MYB12_ARATH; Transcription factor MYB12
TrEMBLA0A022RVL47e-58A0A022RVL4_ERYGU; Uncharacterized protein (Fragment)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47460.14e-40myb domain protein 12
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Pandey A, et al.
    Co-expression of Arabidopsis transcription factor, AtMYB12, and soybean isoflavone synthase, GmIFS1, genes in tobacco leads to enhanced biosynthesis of isoflavones and flavonols resulting in osteoprotective activity.
    Plant Biotechnol. J., 2014. 12(1): p. 69-80
    [PMID:24102754]
  3. Schenke D,Cai D,Scheel D
    Suppression of UV-B stress responses by flg22 is regulated at the chromatin level via histone modification.
    Plant Cell Environ., 2014. 37(7): p. 1716-21
    [PMID:24450952]
  4. Pandey A, et al.
    AtMYB12 expression in tomato leads to large scale differential modulation in transcriptome and flavonoid content in leaf and fruit tissues.
    Sci Rep, 2015. 5: p. 12412
    [PMID:26206248]
  5. Lotkowska ME, et al.
    The Arabidopsis Transcription Factor MYB112 Promotes Anthocyanin Formation during Salinity and under High Light Stress.
    Plant Physiol., 2015. 169(3): p. 1862-80
    [PMID:26378103]
  6. Bulgakov VP,Veremeichik GN,Grigorchuk VP,Rybin VG,Shkryl YN
    The rolB gene activates secondary metabolism in Arabidopsis calli via selective activation of genes encoding MYB and bHLH transcription factors.
    Plant Physiol. Biochem., 2016. 102: p. 70-9
    [PMID:26913794]
  7. Li Y, et al.
    Development of Marker-Free Transgenic Potato Tubers Enriched in Caffeoylquinic Acids and Flavonols.
    J. Agric. Food Chem., 2016. 64(14): p. 2932-40
    [PMID:27019017]
  8. Zhou Z,Schenke D,Miao Y,Cai D
    Investigation of the crosstalk between the flg22 and the UV-B-induced flavonol pathway in Arabidopsis thaliana seedlings.
    Plant Cell Environ., 2017. 40(3): p. 453-458
    [PMID:28032363]
  9. Wang N, et al.
    MYB12 and MYB22 play essential roles in proanthocyanidin and flavonol synthesis in red-fleshed apple (Malus sieversii f. niedzwetzkyana).
    Plant J., 2017. 90(2): p. 276-292
    [PMID:28107780]
  10. Stracke R,Turgut-Kara N,Weisshaar B
    The AtMYB12 activation domain maps to a short C-terminal region of the transcription factor.
    Z. Naturforsch., C, J. Biosci., 2017. 72(7-8): p. 251-257
    [PMID:28284041]
  11. Mondal SK,Roy S
    Genome-wide sequential, evolutionary, organizational and expression analyses of phenylpropanoid biosynthesis associated MYB domain transcription factors in Arabidopsis.
    J. Biomol. Struct. Dyn., 2018. 36(6): p. 1577-1601
    [PMID:28490275]
  12. Hidalgo D, et al.
    Tailoring tobacco hairy root metabolism for the production of stilbenes.
    Sci Rep, 2017. 7(1): p. 17976
    [PMID:29269790]