PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.N02723.1.p
Common NameMIMGU_mgv1a022221mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family MYB
Protein Properties Length: 299aa    MW: 33107.5 Da    PI: 8.2321
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.N02723.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.46.8e-181661147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                      +g+W+++Ed+ll ++v+++G+++W++I++ +  gR++k+c++rw + 
  Migut.N02723.1.p 16 KGPWSPDEDDLLQRLVEKHGPRNWSLISKSIL-GRSGKSCRLRWCNQ 61
                      79*****************************9.***********985 PP

2Myb_DNA-binding52.11.5e-1670112347
                       SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       ++T++Ed+ +++a+ ++G++ W+tIar +  gRt++ +k++w++ 
  Migut.N02723.1.p  70 PFTPQEDDAIIEAHFKYGNK-WATIARFLS-GRTDNAIKNHWNST 112
                       89******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.6661166IPR017930Myb domain
SuperFamilySSF466893.16E-3213109IPR009057Homeodomain-like
SMARTSM007172.9E-161564IPR001005SANT/Myb domain
PfamPF002494.9E-181661IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.3E-241769IPR009057Homeodomain-like
CDDcd001679.35E-161860No hitNo description
SMARTSM007177.1E-1567115IPR001005SANT/Myb domain
PROSITE profilePS5129420.42568117IPR017930Myb domain
CDDcd001673.05E-1270113No hitNo description
PfamPF002495.6E-1470112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.0E-2270116IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 299 aa     Download sequence    Send to blast
MAPPEIGRSE AADRIKGPWS PDEDDLLQRL VEKHGPRNWS LISKSILGRS GKSCRLRWCN  60
QLSPQVEHRP FTPQEDDAII EAHFKYGNKW ATIARFLSGR TDNAIKNHWN STLKRKCLSM  120
SEEYFSSFDP EAQQQQPPLK RSASVGPGSD ISPSGSDTSD STHHHLYRPV ARTCPIELQT  180
DLVTSLSLSL PGSDTNQKPE PDSNQKLRME QPALGTGPTL LQPAPIAHIA MPPPPPPAAQ  240
LPSQQFFSAE FLAVMQEMVR KEVREYMAGN GVDRNGLCVQ SEVIRNAVVK RMGISKIN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A2e-37151173105MYB PROTO-ONCOGENE PROTEIN
1mse_C2e-37151173105C-Myb DNA-Binding Domain
1msf_C2e-37151173105C-Myb DNA-Binding Domain
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that functions in salt stress response. Acts as negative regulator of NHX7/SOS1 and CBL4/SOS3 induction in response to salt stress (PubMed:23809151). In response to auxin, activates the transcription of the auxin-responsive gene IAA19. The IAA19 transcription activation by MYB73 is enhanced by direct interaction between MYB73 and PYL8 (PubMed:24894996). {ECO:0000269|PubMed:23809151, ECO:0000269|PubMed:24894996}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapMigut.N02723.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by salt stress. {ECO:0000269|PubMed:23809151}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012838737.10.0PREDICTED: transcription factor MYB44-like
SwissprotO231608e-79MYB73_ARATH; Transcription factor MYB73
TrEMBLA0A022R9950.0A0A022R995_ERYGU; Uncharacterized protein (Fragment)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA15862471
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37260.12e-70myb domain protein 73
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]