PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Migut.N02067.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 116aa MW: 13479.2 Da PI: 9.2675 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 76.3 | 4.4e-24 | 1 | 68 | 16 | 84 |
NF-YB 16 imkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplk 84 +mkk++P+ aki ++ k + vsefi fvt+easd+c+re+rkt+n d++wal+ l f++y +++ Migut.N02067.1.p 1 MMKKIMPQSAKIQEKQKRE-SKFVSEFICFVTGEASDRCNRENRKTVNKYDICWALSLLRFDNYSDAML 68 69**********9998876.579******************************************9984 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF00808 | 4.0E-10 | 1 | 55 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
SuperFamily | SSF47113 | 3.77E-16 | 1 | 94 | IPR009072 | Histone-fold |
Gene3D | G3DSA:1.10.20.10 | 2.4E-20 | 1 | 89 | IPR009072 | Histone-fold |
PRINTS | PR00615 | 6.9E-5 | 19 | 37 | No hit | No description |
PRINTS | PR00615 | 6.9E-5 | 38 | 56 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 116 aa Download sequence Send to blast |
MMKKIMPQSA KIQEKQKRES KFVSEFICFV TGEASDRCNR ENRKTVNKYD ICWALSLLRF 60 DNYSDAMLRV NKSKNKTNNN CSSEEKDDER NFRDSTTPFD FGILETGRKS LANPY* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5g49_A | 8e-16 | 1 | 67 | 21 | 88 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6 |
Search in ModeBase |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Migut.N02067.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012850788.1 | 3e-34 | PREDICTED: nuclear transcription factor Y subunit B-4-like | ||||
TrEMBL | A0A022RQ78 | 6e-42 | A0A022RQ78_ERYGU; Uncharacterized protein (Fragment) | ||||
STRING | Migut.N02067.1.p | 2e-80 | (Erythranthe guttata) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G09030.1 | 1e-21 | nuclear factor Y, subunit B4 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Migut.N02067.1.p |