PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Migut.L01769.1.p

Organism

Mimulus guttatus

Taxonomic ID

4155

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe

Family

ZF-HD

Protein Properties

Length: 87aa MW: 9684.21 Da PI: 8.6099

Description

ZF-HD family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Migut.L01769.1.p	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	ZF-HD_dimer	94.9	6.8e-30	32	84	3	56
ZF-HD_dimer 3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRre 56 v+Y+eC+kNhAas+G +avDGC+Efmp+ g+eg++aal+CaAC CHRnFH++ Migut.L01769.1.p 32 VVTYEECRKNHAASIGKYAVDGCCEFMPA-GDEGSSAALRCAACSCHRNFHKKV 84 689***********************9.999*****************97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF04770	1.8E-28	33	84	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDom	PD125774	2.0E-10	33	83	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMs	TIGR01566	2.4E-25	34	83	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profile	PS51523	24.554	35	84	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain

Sequence ? help Back to Top
Protein Sequence Length: 87 aa Download sequence Send to blast
MMRSFLLTVG LPYSKMNLIQ NERKIPDKDE RVVTYEECRK NHAASIGKYA VDGCCEFMPA 60 GDEGSSAALR CAACSCHRNF HKKVVR*

Functional Description ? help Back to Top
Source	Description
UniProt	Essential protein. Putative transcription factor.
UniProt	Inhibits zinc finger homeodomain (ZHD) transcription factors, such as ZHD5, by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by preventing the expression of genes involved in gibberellic acid (GA), auxin and brassinosteroid signaling and by promoting the expression of abscisic acid (ABA)-responsive genes. Regulates several development aspects, including photomorphogenesis, apical dominance, longevity, flower morphology and fertility, as well as root and stem elongation. Promotes the formation of ectopic shoot meristems on leaf margins. {ECO:0000269\|PubMed:16412086, ECO:0000269\|PubMed:21059647, ECO:0000269\|PubMed:21455630}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Migut.L01769.1.p

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_010246148.1	1e-26	PREDICTED: mini zinc finger protein 2-like
Swissprot	Q9CA51	5e-21	MIF1_ARATH; Mini zinc finger protein 1
Swissprot	Q9SB61	3e-20	ZHD2_ARATH; Zinc-finger homeodomain protein 2
TrEMBL	A0A022RI98	1e-41	A0A022RI98_ERYGU; Uncharacterized protein (Fragment)
STRING	Migut.L01769.1.p	6e-59	(Erythranthe guttata)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA1105	24	86

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G74660.1	4e-15	mini zinc finger 1

Link Out ? help Back to Top
Phytozome	Migut.L01769.1.p

Publications ? help Back to Top
Bueso E,Serrano R,Pallás V,Sánchez-Navarro JA Seed tolerance to deterioration in arabidopsis is affected by virus infection. Plant Physiol. Biochem., 2017. 116: p. 1-8 [PMID:28477474]