PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Migut.K00431.1.p | ||||||||
Common Name | LOC105960643, MIMGU_mgv1a019124mg | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 171aa MW: 19755.6 Da PI: 10.7173 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 45.2 | 2.2e-14 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g W +eEd +l ++v+ +G g+W+t +++ g R +k+c++rw +yl Migut.K00431.1.p 14 KGFWKPEEDFILRKYVETHGEGNWTTLSKKSGSMRGGKSCRLRWKNYL 61 688*****************************9999**********97 PP | |||||||
2 | Myb_DNA-binding | 50.4 | 5.1e-16 | 70 | 112 | 4 | 48 |
S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 ++++E +l+++++k+lG++ W++Ia +++ gRt++++k++w+++l Migut.K00431.1.p 70 MSEDEKDLIIRLHKLLGNR-WSLIAGRLP-GRTDNEVKNYWNTHL 112 79*****************.*********.************996 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 15.797 | 9 | 61 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.43E-28 | 11 | 108 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 8.6E-12 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.5E-12 | 15 | 61 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 5.71E-9 | 17 | 61 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 1.8E-20 | 17 | 68 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 23.59 | 62 | 116 | IPR017930 | Myb domain |
SMART | SM00717 | 6.2E-14 | 66 | 114 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.6E-14 | 68 | 112 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.9E-22 | 69 | 114 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.75E-10 | 70 | 112 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0010026 | Biological Process | trichome differentiation | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 171 aa Download sequence Send to blast |
MEGTSKESKP RFKKGFWKPE EDFILRKYVE THGEGNWTTL SKKSGSMRGG KSCRLRWKNY 60 LRPNIKHGMM SEDEKDLIIR LHKLLGNRWS LIAGRLPGRT DNEVKNYWNT HLNKTKLCPT 120 ITTTSKKRQL SLSTTSRHQE HVGEKKETTA DNSNVVDSWV DHKTTTKIKT * |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 1e-23 | 10 | 114 | 3 | 106 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activation factor positively regulating trichomes development (PubMed:24803498). Has a function nearly equivalent to that of GL1 and can complement gl1 mutants (PubMed:24803498). {ECO:0000269|PubMed:24803498}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Migut.K00431.1.p |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By auxin (IAA). {ECO:0000269|PubMed:9839469}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012840284.1 | 1e-122 | PREDICTED: transcription factor MYB82-like | ||||
Swissprot | Q9LTF7 | 4e-60 | MYB82_ARATH; Transcription factor MYB82 | ||||
TrEMBL | A0A022R447 | 1e-121 | A0A022R447_ERYGU; Uncharacterized protein |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA12 | 24 | 2154 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G52600.1 | 4e-55 | myb domain protein 82 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Migut.K00431.1.p |
Entrez Gene | 105960643 |