PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Migut.J00635.1.p | ||||||||
Common Name | LOC105958363, MIMGU_mgv1a018118mg | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 134aa MW: 15248.5 Da PI: 8.477 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 110.1 | 1.7e-34 | 11 | 111 | 1 | 101 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkae 93 aCaaCk++rrkC+++C+la+yfpae++ +++ v lFG++n+lk+lk+++e+er++a++sl++eA++r++ Pv+G ++v +kl+ ++e++++e Migut.J00635.1.p 11 ACAACKHQRRKCNQNCTLAKYFPAEKSDDYEKVYNLFGMQNMLKILKSVDEDERDTAIESLIMEARMRLEYPVHGHFSVARKLSFEIEKAEKE 103 7******************************************************************************************** PP DUF260 94 lallkeel 101 l+ +++++ Migut.J00635.1.p 104 LEIVRQKI 111 ***99985 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 22.791 | 10 | 111 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 5.0E-32 | 11 | 108 | IPR004883 | Lateral organ boundaries, LOB |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 134 aa Download sequence Send to blast |
MANAGPSVYK ACAACKHQRR KCNQNCTLAK YFPAEKSDDY EKVYNLFGMQ NMLKILKSVD 60 EDERDTAIES LIMEARMRLE YPVHGHFSVA RKLSFEIEKA EKELEIVRQK IHICKGADNR 120 AGPSTREERP GQP* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 1e-18 | 2 | 111 | 2 | 111 | LOB family transfactor Ramosa2.1 |
5ly0_B | 1e-18 | 2 | 111 | 2 | 111 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Migut.J00635.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012837825.1 | 1e-96 | PREDICTED: LOB domain-containing protein 7-like | ||||
TrEMBL | A0A022RBQ3 | 3e-95 | A0A022RBQ3_ERYGU; Uncharacterized protein | ||||
STRING | Migut.J00635.1.p | 5e-96 | (Erythranthe guttata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA2866 | 17 | 52 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G72980.1 | 1e-28 | LOB domain-containing protein 7 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Migut.J00635.1.p |
Entrez Gene | 105958363 |