PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Migut.J00626.1.p | ||||||||
Common Name | LOC105966475, MIMGU_mgv1a024093mg | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 134aa MW: 15204.5 Da PI: 8.5032 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 114.1 | 9.2e-36 | 12 | 111 | 2 | 101 |
DUF260 2 CaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 CaaCk++rrkC ++Cvla+yfpae++ +f+nv +lFG++n lk+lk+++eeer+++++sl++eA++r++ Pv+G ++v +kl+ ++e++k+el Migut.J00626.1.p 12 CAACKHQRRKCDQNCVLAKYFPAERSDDFENVYHLFGMQNTLKILKSVEEEERDATIESLIMEAKMRLEHPVHGHFSVARKLSIEIEKTKKEL 104 ********************************************************************************************* PP DUF260 95 allkeel 101 + +++++ Migut.J00626.1.p 105 EIVRQKI 111 **99985 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 22.744 | 10 | 111 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 4.2E-33 | 12 | 108 | IPR004883 | Lateral organ boundaries, LOB |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 134 aa Download sequence Send to blast |
MANAFPVAQK HCAACKHQRR KCDQNCVLAK YFPAERSDDF ENVYHLFGMQ NTLKILKSVE 60 EEERDATIES LIMEAKMRLE HPVHGHFSVA RKLSIEIEKT KKELEIVRQK IHICKGADNR 120 AGPSTRGGQS DQL* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 2e-20 | 2 | 105 | 2 | 105 | LOB family transfactor Ramosa2.1 |
5ly0_B | 2e-20 | 2 | 105 | 2 | 105 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Migut.J00626.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012846488.1 | 3e-96 | PREDICTED: LOB domain-containing protein 7-like | ||||
TrEMBL | A0A022RYR6 | 7e-95 | A0A022RYR6_ERYGU; Uncharacterized protein | ||||
STRING | Migut.J00626.1.p | 1e-95 | (Erythranthe guttata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA2866 | 17 | 52 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G72980.1 | 2e-24 | LOB domain-containing protein 7 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Migut.J00626.1.p |
Entrez Gene | 105966475 |