PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Migut.E00756.1.p | ||||||||
Common Name | MIMGU_mgv1a020215mg | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 135aa MW: 15374.5 Da PI: 7.4092 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 105.2 | 5.3e-33 | 11 | 111 | 1 | 101 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkae 93 aCaaCk++rr+C ++C la+yfpae++ +f+ v +l+G++n lk+lk+++eeer+++++sl++eA++r++ Pv+G ++v +kl+ +++++++e Migut.E00756.1.p 11 ACAACKHQRRRCDANCELAKYFPAEKADDFEDVYHLYGMQNTLKILKSVEEEERDKTIESLIMEAKMRLEYPVHGHFSVARKLSIEIDKAEKE 103 7******************************************************************************************** PP DUF260 94 lallkeel 101 l+ +++++ Migut.E00756.1.p 104 LEFVRRQI 111 **999875 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 21.894 | 10 | 111 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 7.2E-31 | 11 | 108 | IPR004883 | Lateral organ boundaries, LOB |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 135 aa Download sequence Send to blast |
MANAVSVVQK ACAACKHQRR RCDANCELAK YFPAEKADDF EDVYHLYGMQ NTLKILKSVE 60 EEERDKTIES LIMEAKMRLE YPVHGHFSVA RKLSIEIDKA EKELEFVRRQ IQLFRGSDNR 120 AGPSTCREGQ PGQP* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 9e-17 | 12 | 111 | 12 | 111 | LOB family transfactor Ramosa2.1 |
5ly0_B | 9e-17 | 12 | 111 | 12 | 111 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Migut.E00756.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012844527.1 | 6e-97 | PREDICTED: LOB domain-containing protein 27-like | ||||
TrEMBL | A0A022RXN7 | 8e-93 | A0A022RXN7_ERYGU; Uncharacterized protein (Fragment) | ||||
STRING | Migut.E00756.1.p | 2e-96 | (Erythranthe guttata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA2866 | 17 | 52 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G47870.1 | 6e-28 | LOB domain-containing protein 27 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Migut.E00756.1.p |