PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Migut.E00755.1.p | ||||||||
Common Name | LOC105964543, MIMGU_mgv1a019497mg | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 133aa MW: 15308.4 Da PI: 7.0302 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 106.2 | 2.6e-33 | 9 | 109 | 1 | 101 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkae 93 aCaaCk++rr+C ++C la+yfpae++ +f+ v +l+G++n+lk+lk+++eeer+++++sl++eA++r++ Pv+G ++v +kl+ +++++++e Migut.E00755.1.p 9 ACAACKHQRRRCDANCELAKYFPAEKADDFEDVYHLYGMQNMLKILKSVEEEERDKTIESLIMEAKMRLEYPVHGHFSVARKLSIEIDKAEKE 101 7******************************************************************************************** PP DUF260 94 lallkeel 101 l+ +++++ Migut.E00755.1.p 102 LEFVRRQI 109 **999875 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:4.10.240.10 | 8.2E-4 | 7 | 23 | IPR001138 | Zn(2)-C6 fungal-type DNA-binding domain |
PROSITE profile | PS50891 | 22.101 | 8 | 109 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 2.5E-31 | 9 | 106 | IPR004883 | Lateral organ boundaries, LOB |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0000981 | Molecular Function | RNA polymerase II transcription factor activity, sequence-specific DNA binding | ||||
GO:0008270 | Molecular Function | zinc ion binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 133 aa Download sequence Send to blast |
MANAVPHKAC AACKHQRRRC DANCELAKYF PAEKADDFED VYHLYGMQNM LKILKSVEEE 60 ERDKTIESLI MEAKMRLEYP VHGHFSVARK LSIEIDKAEK ELEFVRRQIQ LFRGSDNQAG 120 PSTRREGQPD QP* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 7e-17 | 10 | 103 | 12 | 105 | LOB family transfactor Ramosa2.1 |
5ly0_B | 7e-17 | 10 | 103 | 12 | 105 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Migut.E00755.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012844519.1 | 2e-95 | PREDICTED: LOB domain-containing protein 27-like | ||||
TrEMBL | A0A022S1Y5 | 1e-88 | A0A022S1Y5_ERYGU; Uncharacterized protein | ||||
STRING | Migut.E00755.1.p | 9e-95 | (Erythranthe guttata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA2866 | 17 | 52 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G47870.1 | 2e-28 | LOB domain-containing protein 27 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Migut.E00755.1.p |
Entrez Gene | 105964543 |