PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.D01555.1.p
Common NameMIMGU_mgv1a021220mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family WOX
Protein Properties Length: 362aa    MW: 40185.2 Da    PI: 6.0472
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.D01555.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox70.32.4e-2283142357
                       --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
          Homeobox   3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                       +R+++t+eql++Leel+++ +r+psae++++++++l    +++ ++V++WFqN++a+e++
  Migut.D01555.1.p  83 SRWNPTPEQLQTLEELYRRgTRTPSAEQIQQITAQLrrygKIEGKNVFYWFQNHKARERQ 142
                       7*****************99**************************************97 PP

2Wus_type_Homeobox116.11.6e-3782144365
  Wus_type_Homeobox   3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                        ++RW+PtpeQ++ Leely++G+rtP++e+iq+ita+L++yGkie+kNVfyWFQN+kaRerqk+
   Migut.D01555.1.p  82 SSRWNPTPEQLQTLEELYRRGTRTPSAEQIQQITAQLRRYGKIEGKNVFYWFQNHKARERQKR 144
                        79***********************************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003891.5E-580147IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.604.0E-983142IPR009057Homeodomain-like
PfamPF000464.0E-2083142IPR001356Homeobox domain
SuperFamilySSF466892.48E-1283146IPR009057Homeodomain-like
CDDcd000861.09E-684144No hitNo description
PROSITE profilePS5007111.48388143IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048513Biological Processanimal organ development
GO:0099402Biological Processplant organ development
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 362 aa     Download sequence    Send to blast
MMWMMGCNDG GDFDSIQDPF TGRKLRPLMP RPAATAAAAA ASTPPCFAAR IHGTDLLALN  60
HHLAAMAEQN KRELNTQQVV VSSRWNPTPE QLQTLEELYR RGTRTPSAEQ IQQITAQLRR  120
YGKIEGKNVF YWFQNHKARE RQKRRRHLES LCDEHQPHHH NNNNNIQIND TAQKRQEPAA  180
GGNRTAFEVE QTKNWASLTN SSTTNPEKSG EMAAECKLGS DGWVQFDEED ENDDPDETQQ  240
RRNATWQMMH LSCSSSISPT TLHSSLTSSS AATPTMEMHH HHHPDFINIF FDPHQNLGRS  300
GGGGGGGGGV IEETQTLQLF PLESSGGGGG GGQDEEEEEG WAGVNSVTPP YKFFEFLPVK  360
N*
Cis-element ? help Back to Top
SourceLink
PlantRegMapMigut.D01555.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012853221.10.0PREDICTED: WUSCHEL-related homeobox 1-like
TrEMBLA0A022QA430.0A0A022QA43_ERYGU; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA46812342
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18010.16e-45WUSCHEL related homeobox 1