PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Migut.D01107.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 131aa MW: 14890 Da PI: 6.3495 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 110.6 | 1.2e-34 | 8 | 108 | 1 | 101 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkae 93 aCaaCk++rrkC ++Cvla+yfpae++ +f+nv +lFG++n lk+lk+++eee +++++sl++eAe+r++ Pv+G ++v +kl+ ++e++++e Migut.D01107.1.p 8 ACAACKHQRRKCDQNCVLAKYFPAEKSDDFENVYHLFGMQNTLKILKSVEEEEGDATIESLIMEAEMRLEHPVHGHFSVTRKLSIEIEKTETE 100 7******************************************************************************************** PP DUF260 94 lallkeel 101 l+ +++++ Migut.D01107.1.p 101 LEFVRKQI 108 ***99986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:4.10.240.10 | 6.4E-4 | 5 | 22 | IPR001138 | Zn(2)-C6 fungal-type DNA-binding domain |
PROSITE profile | PS50891 | 22.404 | 7 | 108 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 3.5E-32 | 8 | 105 | IPR004883 | Lateral organ boundaries, LOB |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0000981 | Molecular Function | RNA polymerase II transcription factor activity, sequence-specific DNA binding | ||||
GO:0008270 | Molecular Function | zinc ion binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 131 aa Download sequence Send to blast |
MANVAQKACA ACKHQRRKCD QNCVLAKYFP AEKSDDFENV YHLFGMQNTL KILKSVEEEE 60 GDATIESLIM EAEMRLEHPV HGHFSVTRKL SIEIEKTETE LEFVRKQIQL CKGVDNRPGP 120 STREGRPDQL * |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 1e-18 | 5 | 108 | 8 | 111 | LOB family transfactor Ramosa2.1 |
5ly0_B | 1e-18 | 5 | 108 | 8 | 111 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Migut.D01107.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012852620.1 | 5e-94 | PREDICTED: LOB domain-containing protein 7-like | ||||
TrEMBL | A0A022RYR6 | 7e-77 | A0A022RYR6_ERYGU; Uncharacterized protein | ||||
STRING | Migut.D01107.1.p | 2e-93 | (Erythranthe guttata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA2866 | 17 | 52 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G72980.1 | 6e-31 | LOB domain-containing protein 7 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Migut.D01107.1.p |