PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.C01099.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family MYB
Protein Properties Length: 282aa    MW: 31907.6 Da    PI: 10.1652
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.C01099.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.66.1e-182469147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                      rg W + Ede+l ++v+q+G+ +W++Ia +++ gR++k+c++rw++ 
  Migut.C01099.1.p 24 RGHWRPAEDEKLRQLVEQFGPQNWNSIADKLQ-GRSGKSCRLRWFNQ 69
                      899*****************************.***********996 PP

2Myb_DNA-binding551.9e-1776119146
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       r +++ eE+e+l+ a++ +G++ W++I+r ++ gRt++ +k++w+ 
  Migut.C01099.1.p  76 RRPFSDEEEERLLAAHAIHGNK-WALISRIFP-GRTDNAVKNHWHV 119
                       679*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.5081570IPR017930Myb domain
SuperFamilySSF466897.11E-2923117IPR009057Homeodomain-like
SMARTSM007172.1E-142372IPR001005SANT/Myb domain
PfamPF002494.4E-172469IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.5E-272577IPR009057Homeodomain-like
CDDcd001672.56E-132768No hitNo description
PROSITE profilePS5129426.88371125IPR017930Myb domain
SMARTSM007176.9E-1575123IPR001005SANT/Myb domain
PfamPF002492.8E-1476118IPR001005SANT/Myb domain
CDDcd001673.22E-1178118No hitNo description
Gene3DG3DSA:1.10.10.602.3E-2078124IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 282 aa     Download sequence    Send to blast
MDETAACGGG GSSGDPIIRT TSPRGHWRPA EDEKLRQLVE QFGPQNWNSI ADKLQGRSGK  60
SCRLRWFNQL DPRINRRPFS DEEEERLLAA HAIHGNKWAL ISRIFPGRTD NAVKNHWHVI  120
MARKQREKSN LISGKISDDQ STKLSRSTTY VFRRKKSRFQ EDNYGSKISF ENGGIFDSHK  180
DKIFSLSSGS YTSPWPNYNS SANYSDLFGP KNNNPRMLAT IPFNHRLSNF SSSTPFISYL  240
ECGESSFSFS KTRTSGENNK QIEEKSKKDV PFIDFLGVGI L*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-29241247107B-MYB
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapMigut.C01099.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012843295.10.0PREDICTED: trichome differentiation protein GL1-like
TrEMBLA0A022QUW61e-170A0A022QUW6_ERYGU; Uncharacterized protein (Fragment)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA17842466
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G17950.12e-65myb domain protein 52