PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Manes.12G122200.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
|
||||||||
Family | M-type_MADS | ||||||||
Protein Properties | Length: 101aa MW: 11243.2 Da PI: 10.8371 | ||||||||
Description | M-type_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 83.7 | 1.1e-26 | 10 | 59 | 2 | 51 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 ri+n++ rqvtfskRr+g++KKA+EL +LCdaev + ifss+gklye++s Manes.12G122200.1.p 10 RIDNSTSRQVTFSKRRKGLIKKAKELAILCDAEVGLAIFSSSGKLYEFAS 59 8***********************************************86 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 4.8E-37 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 30.796 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 5.76E-28 | 2 | 72 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 4.71E-36 | 2 | 60 | No hit | No description |
PRINTS | PR00404 | 4.4E-28 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 1.2E-24 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.4E-28 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.4E-28 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 101 aa Download sequence Send to blast |
MGRGKIVIRR IDNSTSRQVT FSKRRKGLIK KAKELAILCD AEVGLAIFSS SGKLYEFAST 60 RLDMFFSTTT SIVSLLLLQN YNHQFLLSAL IVSWEKLASL * |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
6bz1_A | 5e-20 | 1 | 63 | 1 | 63 | MEF2 CHIMERA |
6bz1_B | 5e-20 | 1 | 63 | 1 | 63 | MEF2 CHIMERA |
6bz1_C | 5e-20 | 1 | 63 | 1 | 63 | MEF2 CHIMERA |
6bz1_D | 5e-20 | 1 | 63 | 1 | 63 | MEF2 CHIMERA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional factor that targets the CArG motif 5'-C(A/T)TTAAAAAG-3' in the promoter of D14. Directly suppresses D14 expression to control the outgrowth of axillary buds. {ECO:0000269|PubMed:23463009}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Manes.12G122200.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015890524.1 | 2e-35 | MADS-box transcription factor 23 | ||||
Refseq | XP_022741403.1 | 1e-35 | agamous-like MADS-box protein AGL21 | ||||
Swissprot | Q6Z6W2 | 3e-32 | MAD57_ORYSJ; MADS-box transcription factor 57 | ||||
TrEMBL | A0A2C9UVZ9 | 5e-65 | A0A2C9UVZ9_MANES; Uncharacterized protein | ||||
STRING | cassava4.1_022451m | 2e-35 | (Manihot esculenta) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF119 | 33 | 360 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G37940.1 | 2e-34 | AGAMOUS-like 21 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Manes.12G122200.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|