PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Manes.07G046000.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
|
||||||||
Family | M-type_MADS | ||||||||
Protein Properties | Length: 112aa MW: 12587.4 Da PI: 10.0371 | ||||||||
Description | M-type_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 90.6 | 7.7e-29 | 10 | 59 | 2 | 51 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 ri+n++ rqvtfskRr g+lKKA ELS+LCdaev viifsstgkly+y+s Manes.07G046000.1.p 10 RIDNSTSRQVTFSKRRSGLLKKARELSILCDAEVGVIIFSSTGKLYDYAS 59 8***********************************************86 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 3.0E-40 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 31.721 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 3.72E-44 | 2 | 76 | No hit | No description |
SuperFamily | SSF55455 | 5.76E-33 | 2 | 79 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 3.7E-29 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 3.8E-26 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 3.7E-29 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 3.7E-29 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0007584 | Biological Process | response to nutrient | ||||
GO:0048527 | Biological Process | lateral root development | ||||
GO:0071249 | Biological Process | cellular response to nitrate | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0008134 | Molecular Function | transcription factor binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 112 aa Download sequence Send to blast |
MGRGKIVIRR IDNSTSRQVT FSKRRSGLLK KARELSILCD AEVGVIIFSS TGKLYDYASS 60 SMNSVIERYN KLKEEQNQLM NPASEIKIST ETTSTHHLLR YMASVGDSLI SE |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 1e-23 | 1 | 74 | 1 | 74 | MEF2C |
5f28_B | 1e-23 | 1 | 74 | 1 | 74 | MEF2C |
5f28_C | 1e-23 | 1 | 74 | 1 | 74 | MEF2C |
5f28_D | 1e-23 | 1 | 74 | 1 | 74 | MEF2C |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor. Required for root plasticity in response to nitrate, NO(3)(-). Promotes lateral root growth in a NRT1.1-dependent manner. {ECO:0000269|PubMed:15667327, ECO:0000269|PubMed:17148611, ECO:0000269|PubMed:9430595}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Manes.07G046000.1.p |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by nitrate in root cell culture, (PubMed:9430595, PubMed:17148611). In roots, seems induced by nitrogen (N) deprivation (e.g. nitrate free medium) but rapidly repressed by N re-supply (e.g. nitrate, glutamine and ammonium) (PubMed:16021502). Slight repression in shoots during nitrogen (N) deprivation. {ECO:0000269|PubMed:16021502, ECO:0000269|PubMed:17148611, ECO:0000269|PubMed:9430595}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_021618134.1 | 4e-58 | MADS-box transcription factor 23-like | ||||
Refseq | XP_021659610.1 | 3e-58 | MADS-box transcription factor ANR1-like isoform X4 | ||||
Swissprot | Q9SI38 | 9e-49 | ANR1_ARATH; MADS-box transcription factor ANR1 | ||||
TrEMBL | A0A2C9VIG1 | 2e-75 | A0A2C9VIG1_MANES; Uncharacterized protein (Fragment) | ||||
STRING | XP_002518331.1 | 2e-53 | (Ricinus communis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF119 | 33 | 360 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G14210.1 | 4e-48 | AGAMOUS-like 44 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Manes.07G046000.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|