PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AT2G14210.1

Common Name

AGL44, ANR1, F15N24.5

Organism

Arabidopsis thaliana

Taxonomic ID

3702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

MIKC_MADS

Protein Properties

Length: 234aa MW: 26802.8 Da PI: 10.3064

Description

AGAMOUS-like 44

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT2G14210.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	89.5	1.8e-28	10	59	2	51
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 ri+n++ rqvtfskRr g+lKKA+ELS+LCdaev viifsstgkly+y+s AT2G14210.1 10 RIDNSTSRQVTFSKRRSGLLKKAKELSILCDAEVGVIIFSSTGKLYDYAS 59 8***********************************************86 PP
2	K-box	82.7	8.2e-28	82	170	9	97
K-box 9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkk 97 +++++ + +q+e+a L+++++ Lq+ +R+l+Ge+L+ ++ ++Lq+Le+qL +slk +R kK++l++++i+el +k + +q+en++L++ AT2G14210.1 82 NHASEIKFWQREVASLQQQLQYLQECHRKLVGEELSGMNANDLQNLEDQLVTSLKGVRLKKDQLMTNEIRELNRKGQIIQKENHELQNI 170 688999********************************************************************************975 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	8.0E-40	1	60	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	31.665	1	61	IPR002100	Transcription factor, MADS-box
CDD	cd00265	1.90E-41	2	79	No hit	No description
SuperFamily	SSF55455	2.22E-32	2	92	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.8E-28	3	23	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	1.9E-25	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.8E-28	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.8E-28	38	59	IPR002100	Transcription factor, MADS-box
Pfam	PF01486	5.8E-24	83	169	IPR002487	Transcription factor, K-box
PROSITE profile	PS51297	14.135	87	177	IPR002487	Transcription factor, K-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0007584	Biological Process	response to nutrient
GO:0048527	Biological Process	lateral root development
GO:0071249	Biological Process	cellular response to nitrate
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0008134	Molecular Function	transcription factor binding
GO:0046983	Molecular Function	protein dimerization activity

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0000037	anatomy	shoot apex
PO:0000230	anatomy	inflorescence meristem
PO:0009005	anatomy	root
PO:0009009	anatomy	plant embryo
PO:0009010	anatomy	seed
PO:0009046	anatomy	flower
PO:0025022	anatomy	collective leaf structure
PO:0001078	developmental stage	plant embryo cotyledonary stage
PO:0001081	developmental stage	mature plant embryo stage
PO:0004507	developmental stage	plant embryo bilateral stage
PO:0007611	developmental stage	petal differentiation and expansion stage

Sequence ? help Back to Top
Protein Sequence Length: 234 aa Download sequence Send to blast
MGRGKIVIRR IDNSTSRQVT FSKRRSGLLK KAKELSILCD AEVGVIIFSS TGKLYDYASN 60 SSMKTIIERY NRVKEEQHQL LNHASEIKFW QREVASLQQQ LQYLQECHRK LVGEELSGMN 120 ANDLQNLEDQ LVTSLKGVRL KKDQLMTNEI RELNRKGQII QKENHELQNI VDIMRKENIK 180 LQKKVHGRTN AIEGNSSVDP ISNGTTTYAP PQLQLIQLQP APREKSIRLG LQLS

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5f28_A	2e-19	1	75	1	74	MEF2C
5f28_B	2e-19	1	75	1	74	MEF2C
5f28_C	2e-19	1	75	1	74	MEF2C
5f28_D	2e-19	1	75	1	74	MEF2C
Search in ModeBase

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
At.126	0.0	leaf\| root

Expression -- Microarray ? help Back to Top
Source	ID	E-value
GEO	2959319	0.0
Genevisible	263295_at	0.0
Expression Atlas	AT2G14210	-
AtGenExpress	AT2G14210	-
ATTED-II	AT2G14210	-

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Specifically expressed in roots, mostly in lateral roots (LR) primordia, young emerging LRs, apex and base of LRs, apex of the primary root, and in the stele. Barely detectable in shoots. {ECO:0000269\|PubMed:12837945, ECO:0000269\|PubMed:16021502, ECO:0000269\|PubMed:17148611, ECO:0000269\|PubMed:9430595}.

Functional Description ? help Back to Top
Source	Description
TAIR	MADS box gene, transcription factor
UniProt	Probable transcription factor. Required for root plasticity in response to nitrate, NO(3)(-). Promotes lateral root growth in a NRT1.1-dependent manner. {ECO:0000269\|PubMed:15667327, ECO:0000269\|PubMed:17148611, ECO:0000269\|PubMed:9430595}.

Function -- GeneRIF ? help Back to Top
ANR1 expression in roots of hydroponically grown Arabidopsis plants was specifically regulated by changes in the N supply, being induced by N deprivation and rapidly repressed by N re-supply. [PMID: 16021502] There is evidence for a nitrate-dependent component of the ANR1 signalling pathway. [PMID: 16339770] ANR1 overexpression accelerates early seedling development. [PMID: 22523192]

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT2G14210.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by nitrate in root cell culture, (PubMed:9430595, PubMed:17148611). In roots, seems induced by nitrogen (N) deprivation (e.g. nitrate free medium) but rapidly repressed by N re-supply (e.g. nitrate, glutamine and ammonium) (PubMed:16021502). Slight repression in shoots during nitrogen (N) deprivation. {ECO:0000269\|PubMed:16021502, ECO:0000269\|PubMed:17148611, ECO:0000269\|PubMed:9430595}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Interaction ? help Back to Top
Source	Intact With
BioGRID	AT2G45660, AT3G57230, AT4G37940
IntAct	Search Q9SI38

Phenotype -- Disruption Phenotype ? help Back to Top
Source	Description
UniProt	DISRUPTION PHENOTYPE: Impaired lateral root proliferation in nitrate rich root zones. {ECO:0000269\|PubMed:16021502, ECO:0000269\|PubMed:9430595}.

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT2G14210

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AK228244	0.0	AK228244.1 Arabidopsis thaliana mRNA for hypothetical protein, complete cds, clone: RAFL14-69-G23.
GenBank	BT005861	0.0	BT005861.1 Arabidopsis thaliana At2g14210 gene, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_179033.1	1e-171	AGAMOUS-like 44
Swissprot	Q9SI38	1e-172	ANR1_ARATH; MADS-box transcription factor ANR1
TrEMBL	A0A178VW21	1e-168	A0A178VW21_ARATH; ANR1
STRING	AT2G14210.1	1e-171	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM530	24	105
Representative plant	OGRP16	17	761

Link Out ? help Back to Top
Phytozome	AT2G14210.1
Entrez Gene	815907
iHOP	AT2G14210
wikigenes	AT2G14210

Publications ? help Back to Top
Zhang H,Forde BG Regulation of Arabidopsis root development by nitrate availability. J. Exp. Bot., 2000. 51(342): p. 51-9 [PMID:10938795] Wang R,Guegler K,LaBrie ST,Crawford NM Genomic analysis of a nutrient response in Arabidopsis reveals diverse expression patterns and novel metabolic and potential regulatory genes induced by nitrate. Plant Cell, 2000. 12(8): p. 1491-509 [PMID:10948265] Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] Parenicová L, et al. Molecular and phylogenetic analyses of the complete MADS-box transcription factor family in Arabidopsis: new openings to the MADS world. Plant Cell, 2003. 15(7): p. 1538-51 [PMID:12837945] Yamada K, et al. Empirical analysis of transcriptional activity in the Arabidopsis genome. Science, 2003. 302(5646): p. 842-6 [PMID:14593172] Filleur S,Walch-Liu P,Gan Y,Forde BG Nitrate and glutamate sensing by plant roots. Biochem. Soc. Trans., 2005. 33(Pt 1): p. 283-6 [PMID:15667327] de Folter S, et al. Comprehensive interaction map of the Arabidopsis MADS Box transcription factors. Plant Cell, 2005. 17(5): p. 1424-33 [PMID:15805477] Gan Y,Filleur S,Rahman A,Gotensparre S,Forde BG Nutritional regulation of ANR1 and other root-expressed MADS-box genes in Arabidopsis thaliana. Planta, 2005. 222(4): p. 730-42 [PMID:16021502] Walch-Liu P, et al. Nitrogen regulation of root branching. Ann. Bot., 2006. 97(5): p. 875-81 [PMID:16339770] De Bodt S,Theissen G,Van de Peer Y Promoter analysis of MADS-box genes in eudicots through phylogenetic footprinting. Mol. Biol. Evol., 2006. 23(6): p. 1293-303 [PMID:16581940] Leseberg CH,Li A,Kang H,Duvall M,Mao L Genome-wide analysis of the MADS-box gene family in Populus trichocarpa. Gene, 2006. 378: p. 84-94 [PMID:16831523] Remans T, et al. The Arabidopsis NRT1.1 transporter participates in the signaling pathway triggering root colonization of nitrate-rich patches. Proc. Natl. Acad. Sci. U.S.A., 2006. 103(50): p. 19206-11 [PMID:17148611] Zhang H,Rong H,Pilbeam D Signalling mechanisms underlying the morphological responses of the root system to nitrogen in Arabidopsis thaliana. J. Exp. Bot., 2007. 58(9): p. 2329-38 [PMID:17578866] Walch-Liu P,Forde BG Nitrate signalling mediated by the NRT1.1 nitrate transporter antagonises L-glutamate-induced changes in root architecture. Plant J., 2008. 54(5): p. 820-8 [PMID:18266918] Castaings L, et al. The nodule inception-like protein 7 modulates nitrate sensing and metabolism in Arabidopsis. Plant J., 2009. 57(3): p. 426-35 [PMID:18826430] Feng H, et al. Multiple roles of nitrate transport accessory protein NAR2 in plants. Plant Signal Behav, 2011. 6(9): p. 1286-9 [PMID:21852757] Gan Y,Bernreiter A,Filleur S,Abram B,Forde BG Overexpressing the ANR1 MADS-box gene in transgenic plants provides new insights into its role in the nitrate regulation of root development. Plant Cell Physiol., 2012. 53(6): p. 1003-16 [PMID:22523192] Heyndrickx KS,Vandepoele K Systematic identification of functional plant modules through the integration of complementary data sources. Plant Physiol., 2012. 159(3): p. 884-901 [PMID:22589469] Yan Y,Wang H,Hamera S,Chen X,Fang R miR444a has multiple functions in the rice nitrate-signaling pathway. Plant J., 2014. 78(1): p. 44-55 [PMID:24460537] Jin J, et al. An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors. Mol. Biol. Evol., 2015. 32(7): p. 1767-73 [PMID:25750178] Lei L, et al. Nitrogen use efficiency is regulated by interacting proteins relevant to development in wheat. Plant Biotechnol. J., 2018. 16(6): p. 1214-1226 [PMID:29193541] Sun CH, et al. Chrysanthemum MADS-box transcription factor CmANR1 modulates lateral root development via homo-/heterodimerization to influence auxin accumulation in Arabidopsis. Plant Sci., 2018. 266: p. 27-36 [PMID:29241564] Zhang H,Forde BG An Arabidopsis MADS box gene that controls nutrient-induced changes in root architecture. Science, 1998. 279(5349): p. 407-9 [PMID:9430595]