PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Manes.02G041300.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 198aa MW: 22368.3 Da PI: 5.1842 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 60.2 | 4.3e-19 | 18 | 65 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd++l+++++ +G ++Wk++a + g++R++k+c++rw++yl Manes.02G041300.1.p 18 KGAWTAEEDKILAEYIEVHGAKRWKAVAMKAGLKRCGKSCRLRWLNYL 65 79********************************************97 PP | |||||||
2 | Myb_DNA-binding | 52.9 | 8.2e-17 | 71 | 116 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+ + eE++l+++++k+lG++ W++Ia +++ gRt++++k++w+++l Manes.02G041300.1.p 71 RGNISDEEEDLILRLHKLLGNR-WSLIAGRLP-GRTDNEIKNYWNSHL 116 7899******************.*********.************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 16.882 | 13 | 65 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 2.57E-29 | 17 | 112 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.2E-15 | 17 | 67 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.0E-17 | 18 | 65 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 3.7E-25 | 19 | 72 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.15E-11 | 20 | 65 | No hit | No description |
PROSITE profile | PS51294 | 26.508 | 66 | 120 | IPR017930 | Myb domain |
SMART | SM00717 | 4.3E-16 | 70 | 118 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 4.2E-15 | 71 | 116 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.8E-25 | 73 | 120 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 3.10E-11 | 75 | 116 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009957 | Biological Process | epidermal cell fate specification | ||||
GO:0010090 | Biological Process | trichome morphogenesis | ||||
GO:0045892 | Biological Process | negative regulation of transcription, DNA-templated | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:0048481 | Biological Process | plant ovule development | ||||
GO:0048629 | Biological Process | trichome patterning | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 198 aa Download sequence Send to blast |
MAPVNSEESS NSKMVMNKGA WTAEEDKILA EYIEVHGAKR WKAVAMKAGL KRCGKSCRLR 60 WLNYLRPNIK RGNISDEEED LILRLHKLLG NRWSLIAGRL PGRTDNEIKN YWNSHLSKKI 120 NKMERTPESS IPQESIPDNA AAAAQDMMEE GSQGAVFPEL SFDADGFFDF SMEGSCSLEW 180 VNKFLELDED PWLADKS* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 7e-30 | 16 | 120 | 25 | 128 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator, when associated with BHLH2/EGL3/MYC146 or BHLH12/MYC1. Regulates the epidermal cell fate specification. Mediates the formation of columellae and accumulation of mucilages on seed coats. Controls the elongation of epidermal cells positively in roots but negatively in stems, leading to the promotion of primary roots elongation and repression of leaves and stems elongation, respectively. Ovoids ectopic root-hair formation, probably by inducing GL2 in roots. Controls trichome initiation and branching. {ECO:0000269|PubMed:11437443, ECO:0000269|PubMed:15361138, ECO:0000269|PubMed:15668208, ECO:0000269|PubMed:15728674}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Manes.02G041300.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KM034677 | 3e-42 | KM034677.1 Jatropha curcas clone JcMYB057 MYB family protein gene, complete cds. | |||
GenBank | KM034678 | 3e-42 | KM034678.1 Jatropha curcas clone JcMYB058 MYB family protein gene, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_021603723.1 | 1e-144 | transcription factor MYB114-like | ||||
Refseq | XP_021603724.1 | 1e-144 | transcription factor MYB114-like | ||||
Swissprot | Q96276 | 3e-55 | MYB23_ARATH; Transcription factor MYB23 | ||||
TrEMBL | A0A2C9WB31 | 1e-143 | A0A2C9WB31_MANES; Uncharacterized protein | ||||
STRING | cassava4.1_028721m | 1e-144 | (Manihot esculenta) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF2148 | 32 | 88 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G40330.1 | 1e-57 | myb domain protein 23 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Manes.02G041300.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|