PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MDP0000670737 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
|
||||||||
Family | Trihelix | ||||||||
Protein Properties | Length: 83aa MW: 9579.87 Da PI: 8.4847 | ||||||||
Description | Trihelix family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | trihelix | 27.2 | 9.9e-09 | 28 | 68 | 1 | 41 |
trihelix 1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrer 41 +Wt++e +Li a++e++++lrr++lk +Wee + m++r MDP0000670737 28 QWTQEEMVQLIWAYEEKWHALRRAQLKLSQWEEMAMSMAAR 68 7***********************************99654 PP |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 83 aa Download sequence Send to blast |
MSSPPQSSPM ASVSASSRTS AKKPQPLQWT QEEMVQLIWA YEEKWHALRR AQLKLSQWEE 60 MAMSMAARCD YEYREPSKFT TH* |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009372525.1 | 5e-31 | PREDICTED: uncharacterized protein LOC103961670 | ||||
TrEMBL | A0A498IXM8 | 4e-24 | A0A498IXM8_MALDO; Uncharacterized protein | ||||
STRING | XP_009372525.1 | 2e-30 | (Pyrus x bretschneideri) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF10087 | 28 | 35 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G24860.1 | 3e-11 | Trihelix family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | MDP0000670737 |