PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MDP0000253357 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
|
||||||||
Family | ZF-HD | ||||||||
Protein Properties | Length: 98aa MW: 11044.5 Da PI: 8.6918 | ||||||||
Description | ZF-HD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | ZF-HD_dimer | 106 | 2.2e-33 | 27 | 82 | 4 | 60 |
ZF-HD_dimer 4 vrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60 vrY eC+kNhAa+lGg+a+DGC+Efm+s geegt++al+CaACgCHR+FHR+eve+e MDP0000253357 27 VRYGECQKNHAAKLGGYAIDGCREFMAS-GEEGTTEALTCAACGCHRSFHRKEVETE 82 89*************************9.999*********************9986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF04770 | 7.4E-31 | 27 | 79 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
TIGRFAMs | TIGR01566 | 1.8E-27 | 28 | 79 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
PROSITE profile | PS51523 | 26.258 | 29 | 78 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
ProDom | PD125774 | 1.0E-26 | 29 | 91 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 98 aa Download sequence Send to blast |
MKKRQVVVKR DRSERNSSTS SSMVRIVRYG ECQKNHAAKL GGYAIDGCRE FMASGEEGTT 60 EALTCAACGC HRSFHRKEVE TEVVCEYSPP SSYRKWCT |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Mostly expressed in stems, flowers and siliques, and, to a lower extent, in inflorescence. {ECO:0000269|PubMed:16412086}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Inhibits zinc finger homeodomain (ZHD) transcription factors by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by regulating the expression of specific genes. {ECO:0000269|PubMed:21455630}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_008374543.1 | 2e-67 | mini zinc finger protein 3-like | ||||
Swissprot | Q9LJW5 | 2e-38 | MIF2_ARATH; Mini zinc finger protein 2 | ||||
TrEMBL | M5WFS6 | 2e-50 | M5WFS6_PRUPE; Uncharacterized protein | ||||
STRING | XP_008374543.1 | 6e-67 | (Malus domestica) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF1550 | 34 | 100 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G74660.1 | 5e-37 | mini zinc finger 1 |
Link Out ? help Back to Top | |
---|---|
Phytozome | MDP0000253357 |
Publications ? help Back to Top | |||
---|---|---|---|
|