PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000252640
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family YABBY
Protein Properties Length: 538aa    MW: 59967.2 Da    PI: 8.2388
Description YABBY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000252640genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1YABBY190.96e-5936951224170
          YABBY  24 vsvPstslfkvvtvrCGhCtsllsvnlakasqllaaeshldeslkeelleelkveeenlksnvekeesastsvsseklsenedeevprvppvirPP 119
                    vsvP +s++++vtvrCGhC++llsvn+  + q ++   h ++  k++l  e+ +++   +s  ++++s+s++   + +++ e ++ pr+ p irPP
  MDP0000252640 369 VSVPCNSSMNMVTVRCGHCANLLSVNIGGSLQSTTIPPH-QDPQKQHLSSEDSNKNCGSSSSSSSSSSKSNKFG-HAFESLELHDQPRISP-IRPP 461
                    9*************************************9.5555666666555444444444443333333333.3558889999999999.9*** PP

          YABBY 120 ekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahfPkihfgl 170
                    ekrqrvPsaynrfikeeiqrikasnPdishreafs+aaknWahfP+ihfgl
  MDP0000252640 462 EKRQRVPSAYNRFIKEEIQRIKASNPDISHREAFSTAAKNWAHFPHIHFGL 512
                    *************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046901.3E-58369512IPR006780YABBY protein
SuperFamilySSF470957.59E-8455505IPR009071High mobility group box domain
Gene3DG3DSA:1.10.30.101.9E-4460506IPR009071High mobility group box domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007275Biological Processmulticellular organism development
Sequence ? help Back to Top
Protein Sequence    Length: 538 aa     Download sequence    Send to blast
MSLWLITIGC HFTSGSGASI YWACSXPEXA QGFASPNPHV DTXEADANSV XVHPRETELG  60
RSSRCXGVLE ACIRTGSLVI TQNKIVVDYX QLHWRANLEV NXLLTHDIVA IIHTKYPMLS  120
SSWKNFSLEM RKEMMRQIST CASPXKALXD LPLEFVERMV EWESLYFLII TDSAASLTTS  180
ASLGQPEXAQ GFASPNPHVD TAEADANSVX VHPRETELGR SSRCXGVLEA CIRTGSLVIT  240
QNKIVVDYXQ LHWRANLEVN SLLTHDIVAI IHTKYPMLSS SWKNFSLEMR KEMMRQISGX  300
IRLIRKRSXT FIALILNPSL IGSKNSVRKX PDMPIEELTS DPKMFLQLLI DGVGRQKGKE  360
IHDLRAGQVS VPCNSSMNMV TVRCGHCANL LSVNIGGSLQ STTIPPHQDP QKQHLSSEDS  420
NKNCGSSSSS SSSSSKSNKF GHAFESLELH DQPRISPIRP PEKRQRVPSA YNRFIKEEIQ  480
RIKASNPDIS HREAFSTAAK NWAHFPHIHF GLKLDANREP KLDQAFAGEG TQKSNGFY
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.120990.0fruit| leaf
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF112434112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08465.14e-59YABBY family protein