PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

GSMUA_Achr9P27420_001

Organism

Musa acuminata

Taxonomic ID

4641

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa

Family

MYB_related

Protein Properties

Length: 56aa MW: 6291.58 Da PI: 10.9285

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
GSMUA_Achr9P27420_001	genome	CIRAD	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	26.2	1.8e-08	15	45	2	32
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT CS Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmg 32 g+WT++Ed +lv ++k G+g W++ +++ g GSMUA_Achr9P27420_001 15 GAWTAQEDHILVSYIKVQGKGKWRSLPKRAG 45 89*************************9988 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	7.4E-10	5	43	IPR009057	Homeodomain-like
PROSITE profile	PS50090	6.493	9	56	IPR017877	Myb-like domain
SuperFamily	SSF46689	6.8E-7	9	45	IPR009057	Homeodomain-like
Pfam	PF00249	3.4E-6	14	45	IPR001005	SANT/Myb domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 56 aa Download sequence Send to blast
MGRKPCCARE GLRTGAWTAQ EDHILVSYIK VQGKGKWRSL PKRAGALVIH LCMIKK

Functional Description ? help Back to Top
Source	Description
UniProt	Flavonol-specific transcription activator involved in the regulation of several genes of flavonoid biosynthesis. Activates the expression of CHS, CHI, F3H and FLS1. Controls flavonol biosynthesis primarily in cotyledons and leaves (PubMed:17419845, PubMed:20731781). Confers tolerance to UV-B (PubMed:19895401). {ECO:0000269\|PubMed:17419845, ECO:0000269\|PubMed:19895401, ECO:0000269\|PubMed:20731781}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Triggered by HY5 in response to light and UV-B. {ECO:0000269\|PubMed:19895401}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_009419136.1	5e-24	PREDICTED: anthocyanin regulatory C1 protein-like
Swissprot	Q9FJ07	2e-15	MY111_ARATH; Transcription factor MYB111
TrEMBL	M0U3Z9	4e-33	M0U3Z9_MUSAM; Uncharacterized protein
STRING	GSMUA_Achr9P27420_001	7e-34	(Musa acuminata)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP38014	2	3

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G49330.1	7e-18	myb domain protein 111

Publications ? help Back to Top
Pandey A,Misra P,Bhambhani S,Bhatia C,Trivedi PK Expression of Arabidopsis MYB transcription factor, AtMYB111, in tobacco requires light to modulate flavonol content. Sci Rep, 2014. 4: p. 5018 [PMID:24846090] Lotkowska ME, et al. The Arabidopsis Transcription Factor MYB112 Promotes Anthocyanin Formation during Salinity and under High Light Stress. Plant Physiol., 2015. 169(3): p. 1862-80 [PMID:26378103] Bulgakov VP,Veremeichik GN,Grigorchuk VP,Rybin VG,Shkryl YN The rolB gene activates secondary metabolism in Arabidopsis calli via selective activation of genes encoding MYB and bHLH transcription factors. Plant Physiol. Biochem., 2016. 102: p. 70-9 [PMID:26913794] Zhou Z,Schenke D,Miao Y,Cai D Investigation of the crosstalk between the flg22 and the UV-B-induced flavonol pathway in Arabidopsis thaliana seedlings. Plant Cell Environ., 2017. 40(3): p. 453-458 [PMID:28032363] Mondal SK,Roy S Genome-wide sequential, evolutionary, organizational and expression analyses of phenylpropanoid biosynthesis associated MYB domain transcription factors in Arabidopsis. J. Biomol. Struct. Dyn., 2018. 36(6): p. 1577-1601 [PMID:28490275] Duan S, et al. Functional characterization of a heterologously expressed Brassica napus WRKY41-1 transcription factor in regulating anthocyanin biosynthesis in Arabidopsis thaliana. Plant Sci., 2018. 268: p. 47-53 [PMID:29362083]