PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr8P18730_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family MYB
Protein Properties Length: 370aa    MW: 40185 Da    PI: 7.4332
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr8P18730_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.99.6e-181461148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                           +g W++eEde+l++ ++q+G g+W+++++  g+ R++k+c++rw +yl
  GSMUA_Achr8P18730_001 14 KGLWSPEEDEKLIKHITQFGHGCWSSVPKQAGLQRCGKSCRLRWINYL 61
                           678*******************************************97 PP

2Myb_DNA-binding48.12.7e-1567110146
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                            rg ++++E++l++++++ lG++ W++Ia +++ gRt++++k+ w++
  GSMUA_Achr8P18730_001  67 RGTFSKQEEDLIIELHAVLGNR-WSKIATHLP-GRTDNEIKNLWNS 110
                            899*******************.*********.*********9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.5E-27664IPR009057Homeodomain-like
PROSITE profilePS5129418.543961IPR017930Myb domain
SuperFamilySSF466895.24E-2912108IPR009057Homeodomain-like
SMARTSM007177.3E-131363IPR001005SANT/Myb domain
PfamPF002494.2E-151461IPR001005SANT/Myb domain
CDDcd001676.42E-121761No hitNo description
PROSITE profilePS5129425.71562116IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.5E-2565116IPR009057Homeodomain-like
SMARTSM007171.5E-1366114IPR001005SANT/Myb domain
PfamPF002493.3E-1467110IPR001005SANT/Myb domain
CDDcd001671.58E-1069109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 370 aa     Download sequence    Send to blast
MGGHSCCYKQ KLRKGLWSPE EDEKLIKHIT QFGHGCWSSV PKQAGLQRCG KSCRLRWINY  60
LRPDLKRGTF SKQEEDLIIE LHAVLGNRWS KIATHLPGRT DNEIKNLWNS CIKKKLRQRG  120
IDPNTHKPLA EVDGGDDKAL DNSEKNSGSG GLQLPNSSTC RSPSPMGSFP LPLLSFGPDY  180
SSSLTTSAAL PFSSNPLLWL NQTARQLDAT PELSCNAISA AVSSLSTSAI APPSCAGDST  240
ISNWHAANCN NNPGSSVNES GGFMLQSSCS FDSGIFPWSE LTPDKVVQVQ LGGETEDLKW  300
SEYLHGAFPA SAAVQAQSSQ PFYGDIKGGS QFTISGLSIW QQNQQLQHQL QAADISGKDF  360
QSVSVGFQQI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-28121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009413698.10.0PREDICTED: transcription factor MYB86-like
TrEMBLM0TRM60.0M0TRM6_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr8P18730_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23103794
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09540.14e-87myb domain protein 61