PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSMUA_Achr8P16920_001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 113aa MW: 12835.8 Da PI: 10.2355 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 54.9 | 2.1e-17 | 15 | 62 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd lv +++++G+g+Wk+++ g+ R+ k+c++rw +yl GSMUA_Achr8P16920_001 15 KGPWTPEEDIVLVSYIQEHGPGNWKAVPTNTGLIRCSKSCRLRWTNYL 62 79********************************************97 PP | |||||||
2 | Myb_DNA-binding | 29.7 | 1.5e-09 | 68 | 99 | 1 | 34 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkg 34 rg++T +E++l++++ ++lG++ W++Ia++++ GSMUA_Achr8P16920_001 68 RGNFTDQEEKLIIHLQALLGNR-WAAIASYLP-E 99 89********************.********9.3 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 4.6E-23 | 7 | 65 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 24.25 | 10 | 66 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 2.16E-26 | 12 | 103 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.7E-12 | 14 | 64 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 8.0E-16 | 15 | 62 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.07E-11 | 17 | 62 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 5.6E-14 | 66 | 100 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 0.0073 | 67 | 107 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS51294 | 9.668 | 67 | 113 | IPR017930 | Myb domain |
Pfam | PF00249 | 2.2E-8 | 68 | 100 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 2.71E-5 | 70 | 100 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 113 aa Download sequence Send to blast |
MGRPPPRCDR DGVKKGPWTP EEDIVLVSYI QEHGPGNWKA VPTNTGLIRC SKSCRLRWTN 60 YLRPGIKRGN FTDQEEKLII HLQALLGNRW AAIASYLPER GQIMTSRTTG IHI |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 2e-19 | 13 | 100 | 25 | 111 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. {ECO:0000305}. | |||||
UniProt | Transcription factor that binds specifically to the DNA sequence 5'-AACAAAC-3' (PubMed:19170933). Acts as a positive regulator of hypersensitive cell death (PubMed:10571865, PubMed:12119395). Acts as a positive regulator of salicylic acid synthesis (PubMed:16730712). Regulates very-long-chain fatty acid biosynthesis (PubMed:18326828). Acts cooperatively with BZR2 to promote expression of a subset of brassinosteroids target genes (PubMed:19170933). Transcriptional activity and hypersensitive response control negatively regulated by PLA2-ALPHA and by the Xanthomonas type III effector XopD (AC G9L9K6) (PubMed:20696912, PubMed:21917550). Involved in the regulation of abscisic acid (ABA) signaling (PubMed:22814374). Increased levels of MYB30 can accelerate flowering both in long and short days through the regulation of FT (PubMed:24587042). {ECO:0000269|PubMed:10571865, ECO:0000269|PubMed:12119395, ECO:0000269|PubMed:16730712, ECO:0000269|PubMed:18326828, ECO:0000269|PubMed:19170933, ECO:0000269|PubMed:20696912, ECO:0000269|PubMed:21917550, ECO:0000269|PubMed:22814374, ECO:0000269|PubMed:24587042}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Up-regulated during hypersensitive response, but no expression detected during compatible interaction with pathogens (PubMed:10571865). Specifically induced in the inoculated zone 4 hours post pathogen infection (PubMed:20696912). Up-regulated by jasmonic acid and salicylic acid (PubMed:16463103, PubMed:16730712). Transcriptionally regulated by BZR2 (PubMed:19170933). {ECO:0000269|PubMed:10571865, ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:16730712, ECO:0000269|PubMed:19170933, ECO:0000269|PubMed:20696912}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009412676.1 | 2e-63 | PREDICTED: myb-related protein 306-like | ||||
Refseq | XP_021765881.1 | 3e-63 | myb-related protein 306-like | ||||
Refseq | XP_021765882.1 | 3e-63 | myb-related protein 306-like | ||||
Swissprot | P81392 | 1e-60 | MYB06_ANTMA; Myb-related protein 306 | ||||
Swissprot | Q9SCU7 | 1e-60 | MYB30_ARATH; Transcription factor MYB30 | ||||
TrEMBL | M0TR45 | 1e-78 | M0TR45_MUSAM; Uncharacterized protein | ||||
STRING | GSMUA_Achr8P16920_001 | 2e-79 | (Musa acuminata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP229 | 38 | 296 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G28910.1 | 6e-63 | myb domain protein 30 |