PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AT3G28910.1

Common Name

ATMYB30, hsr1, MLD15.8, MYB30

Organism

Arabidopsis thaliana

Taxonomic ID

3702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

MYB

Protein Properties

Length: 323aa MW: 35918.9 Da PI: 8.068

Description

myb domain protein 30

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT3G28910.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	54.4	2.8e-17	14	61	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd +lv +++++G+g+W++++ g+ R+ k+c++rw +yl AT3G28910.1 14 KGPWTPEEDIILVTYIQEHGPGNWRAVPTNTGLLRCSKSCRLRWTNYL 61 79****************************99**********97 PP
2	Myb_DNA-binding	50.2	6e-16	67	112	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg++T+ E++ +v++ ++lG++ W++Ia++++ Rt++++k++w+++l AT3G28910.1 67 RGNFTEHEEKMIVHLQALLGNR-WAAIASYLP-QRTDNDIKNYWNTHL 112 89******************.*****.**********996 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	1.4E-23	5	64	IPR009057	Homeodomain-like
PROSITE profile	PS51294	17.078	9	61	IPR017930	Myb domain
SuperFamily	SSF46689	1.91E-30	11	108	IPR009057	Homeodomain-like
SMART	SM00717	1.6E-14	13	63	IPR001005	SANT/Myb domain
Pfam	PF00249	5.6E-16	14	61	IPR001005	SANT/Myb domain
CDD	cd00167	9.55E-11	16	61	No hit	No description
PROSITE profile	PS51294	23.739	62	116	IPR017930	Myb domain
Gene3D	G3DSA:1.10.10.60	1.5E-24	65	117	IPR009057	Homeodomain-like
SMART	SM00717	2.5E-15	66	114	IPR001005	SANT/Myb domain
Pfam	PF00249	3.1E-14	67	112	IPR001005	SANT/Myb domain
CDD	cd00167	2.74E-10	69	112	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0001666	Biological Process	response to hypoxia
GO:0006357	Biological Process	regulation of transcription from RNA polymerase II promoter
GO:0009617	Biological Process	response to bacterium
GO:0009626	Biological Process	plant-type hypersensitive response
GO:0009723	Biological Process	response to ethylene
GO:0009733	Biological Process	response to auxin
GO:0009739	Biological Process	response to gibberellin
GO:0009751	Biological Process	response to salicylic acid
GO:0009753	Biological Process	response to jasmonic acid
GO:0030154	Biological Process	cell differentiation
GO:0042761	Biological Process	very long-chain fatty acid biosynthetic process
GO:0005634	Cellular Component	nucleus
GO:0000981	Molecular Function	RNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135	Molecular Function	transcription factor activity, RNA polymerase II transcription factor recruiting
GO:0005515	Molecular Function	protein binding
GO:0043565	Molecular Function	sequence-specific DNA binding
GO:0044212	Molecular Function	transcription regulatory region DNA binding

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0000013	anatomy	cauline leaf
PO:0000037	anatomy	shoot apex
PO:0000263	anatomy	non-hair root epidermal cell
PO:0000293	anatomy	guard cell
PO:0008019	anatomy	leaf lamina base
PO:0009005	anatomy	root
PO:0009006	anatomy	shoot system
PO:0009009	anatomy	plant embryo
PO:0009010	anatomy	seed
PO:0009025	anatomy	vascular leaf
PO:0009029	anatomy	stamen
PO:0009030	anatomy	carpel
PO:0009031	anatomy	sepal
PO:0009032	anatomy	petal
PO:0009046	anatomy	flower
PO:0009047	anatomy	stem
PO:0009052	anatomy	flower pedicel
PO:0020030	anatomy	cotyledon
PO:0020038	anatomy	petiole
PO:0020100	anatomy	hypocotyl
PO:0020137	anatomy	leaf apex
PO:0025022	anatomy	collective leaf structure
PO:0025281	anatomy	pollen
PO:0001054	developmental stage	vascular leaf senescent stage
PO:0001078	developmental stage	plant embryo cotyledonary stage
PO:0001081	developmental stage	mature plant embryo stage
PO:0001185	developmental stage	plant embryo globular stage
PO:0004507	developmental stage	plant embryo bilateral stage
PO:0007064	developmental stage	LP.12 twelve leaves visible stage
PO:0007095	developmental stage	LP.08 eight leaves visible stage
PO:0007098	developmental stage	LP.02 two leaves visible stage
PO:0007103	developmental stage	LP.10 ten leaves visible stage
PO:0007115	developmental stage	LP.04 four leaves visible stage
PO:0007123	developmental stage	LP.06 six leaves visible stage
PO:0007611	developmental stage	petal differentiation and expansion stage
PO:0007616	developmental stage	flowering stage

Sequence ? help Back to Top
Protein Sequence Length: 323 aa Download sequence Send to blast
MVRPPCCDKG GVKKGPWTPE EDIILVTYIQ EHGPGNWRAV PTNTGLLRCS KSCRLRWTNY 60 LRPGIKRGNF TEHEEKMIVH LQALLGNRWA AIASYLPQRT DNDIKNYWNT HLKKKLNKVN 120 QDSHQELDRS SLSSSPSSSS ANSNSNISRG QWERRLQTDI HLAKKALSEA LSPAVAPIIT 180 STVTTTSSSA ESRRSTSSAS GFLRTQETST TYASSTENIA KLLKGWVKNS PKTQNSADQI 240 ASTEVKEVIK SDDGKECAGA FQSFSEFDHS YQQAGVSPDH ETKPDITGCC SNQSQWSLFE 300 KWLFEDSGGQ IGDILLDENT NFF

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1gv2_A	2e-25	14	116	4	105	MYB PROTO-ONCOGENE PROTEIN
1h88_C	8e-25	14	116	58	159	MYB PROTO-ONCOGENE PROTEIN
1h89_C	8e-25	14	116	58	159	MYB PROTO-ONCOGENE PROTEIN
1h8a_C	4e-25	12	116	25	128	MYB TRANSFORMING PROTEIN
Search in ModeBase

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
At.10902	0.0	flower\| root\| seed\| silique

Expression -- Microarray ? help Back to Top
Source	ID	E-value
GEO	145339046	0.0
Genevisible	257140_at	0.0
Expression Atlas	AT3G28910	-
AtGenExpress	AT3G28910	-
ATTED-II	AT3G28910	-

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: Expressed in 2-week-old seedlings, in the early stages of development. {ECO:0000269\|PubMed:10571865}.
Uniprot	TISSUE SPECIFICITY: Expressed in vascular tissues of leaves, hypocotyl and roots. {ECO:0000269\|PubMed:24587042}.

Functional Description ? help Back to Top
Source	Description
TAIR	transcription factor myb homologue
UniProt	Transcription factor that binds specifically to the DNA sequence 5'-AACAAAC-3' (PubMed:19170933). Acts as a positive regulator of hypersensitive cell death (PubMed:10571865, PubMed:12119395). Acts as a positive regulator of salicylic acid synthesis (PubMed:16730712). Regulates very-long-chain fatty acid biosynthesis (PubMed:18326828). Acts cooperatively with BZR2 to promote expression of a subset of brassinosteroids target genes (PubMed:19170933). Transcriptional activity and hypersensitive response control negatively regulated by PLA2-ALPHA and by the Xanthomonas type III effector XopD (AC G9L9K6) (PubMed:20696912, PubMed:21917550). Involved in the regulation of abscisic acid (ABA) signaling (PubMed:22814374). Increased levels of MYB30 can accelerate flowering both in long and short days through the regulation of FT (PubMed:24587042). {ECO:0000269\|PubMed:10571865, ECO:0000269\|PubMed:12119395, ECO:0000269\|PubMed:16730712, ECO:0000269\|PubMed:18326828, ECO:0000269\|PubMed:19170933, ECO:0000269\|PubMed:20696912, ECO:0000269\|PubMed:21917550, ECO:0000269\|PubMed:22814374, ECO:0000269\|PubMed:24587042}.

Function -- GeneRIF ? help Back to Top
BES1 and AtMYB30 function cooperatively to promote brassinosteroid target gene expression. [PMID: 19170933] Results suggest that RNA silencing directly mediates downregulation of AtMYB30 expression, both in young seedlings and in adult plants. [PMID: 20605724] AtMYB30 and the secreted phospholipase AtsPLA(2)-alpha physically interact in vivo, following the AtMYB30-mediated specific relocalization of AtsPLA(2)-alpha from cytoplasmic vesicles to the plant cell nucleus. [PMID: 20696912] coordination of ABI5 and MYB30 sumoylation by SIZ1 may balance gene expression, which is required for regulation of ABA signaling during seed germination. [PMID: 22814374] MIEL1 (MYB30-Interacting E3 Ligase1), an Arabidopsis RING-type E3 ubiquitin ligase that interacts with and ubiquitinates MYB30, leads to MYB30 proteasomal degradation and downregulation of its transcriptional activity. [PMID: 23403577] S-nitrosylation influences the structure and DNA binding activity of MYB30 from Arabidopsis thaliana. [PMID: 24583075] Elevated levels of MYB30 in the phloem accelerate flowering in Arabidopsis through the regulation of FLOWERING LOCUS T. [PMID: 24587042] The SBT5.2 gene produces two distinct transcripts encoding a canonical secreted subtilase [SBT5.2(a)] and an intracellular protein [SBT5.2(b)]. SBT5.2(b) localizes to endosomes where it interacts with and retains the defence-related transcription factor MYB30. [PMID: 27685353] MYB30 regulates oxidative and heat stress responses through calcium signaling, which is at least partially mediated by ANN1 and ANN4. [PMID: 28726305] MYB30-INTERACTING E3 LIGASE 1 (MIEL1) E3 ubiquitin ligase controls the protein stability of the two MYB transcription factors, MYB96 and MYB30, and thereby wax biosynthesis in Arabidopsis. These observations indicate that the MIEL1-MYB96 module is important for balanced cuticular wax biosynthesis in developing inflorescence stems. [PMID: 28838126] showed that MYB30 is necessary for root growth regulation during defense responses [PMID: 29712840] Data show that the RING-type ubiquitin E3 ligase RHA2b, which positively regulates abscisic acid (ABA) signaling, interacted with and ubiquitinated transcription factor MYB30 to modulate MYB30 stability. [PMID: 30030326]

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00386	DAP	27203113	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT3G28910.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Up-regulated during hypersensitive response, but no expression detected during compatible interaction with pathogens (PubMed:10571865). Specifically induced in the inoculated zone 4 hours post pathogen infection (PubMed:20696912). Up-regulated by jasmonic acid and salicylic acid (PubMed:16463103, PubMed:16730712). Transcriptionally regulated by BZR2 (PubMed:19170933). {ECO:0000269\|PubMed:10571865, ECO:0000269\|PubMed:16463103, ECO:0000269\|PubMed:16730712, ECO:0000269\|PubMed:19170933, ECO:0000269\|PubMed:20696912}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source	Target Gene (A: Activate/R: Repress)
ATRM	AT1G01120(A), AT1G02205(A), AT1G04220(A), AT1G74710(A), AT2G26250(A), AT4G33790(A)

Regulation -- Hormone ? help Back to Top
Source	Hormone
AHD	abscisic acid, auxin, Brassinosteroid, ethylene, gibberellin, jasmonic acid, salicylic acid

Interaction ? help Back to Top
Source	Intact With
BioGRID	AT1G19350
IntAct	Search Q9SCU7

Phenotype -- Disruption Phenotype ? help Back to Top
Source	Description
UniProt	DISRUPTION PHENOTYPE: Altered brassinosteroids response phenotypes (PubMed:19170933). Hypersensitivity to ABA during germination and seedling growth (PubMed:22814374). {ECO:0000269\|PubMed:19170933, ECO:0000269\|PubMed:22814374}.

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT3G28910

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AF250339	0.0	AF250339.1 Arabidopsis thaliana Myb30 (Myb30) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_189533.1	0.0	myb domain protein 30
Swissprot	Q9SCU7	0.0	MYB30_ARATH; Transcription factor MYB30
TrEMBL	A0A178VDU0	0.0	A0A178VDU0_ARATH; MYB30
STRING	AT3G28910.1	0.0	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM5842	23	48
Representative plant	OGRP5	17	1784

Link Out ? help Back to Top
Phytozome	AT3G28910.1
Entrez Gene	822525
iHOP	AT3G28910
wikigenes	AT3G28910

Publications ? help Back to Top
Daniel X,Lacomme C,Morel JB,Roby D A novel myb oncogene homologue in Arabidopsis thaliana related to hypersensitive cell death. Plant J., 1999. 20(1): p. 57-66 [PMID:10571865] Kleinow T, et al. Functional identification of an Arabidopsis snf4 ortholog by screening for heterologous multicopy suppressors of snf4 deficiency in yeast. Plant J., 2000. 23(1): p. 115-22 [PMID:10929106] Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] Stracke R,Werber M,Weisshaar B The R2R3-MYB gene family in Arabidopsis thaliana. Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56 [PMID:11597504] Vailleau F, et al. A R2R3-MYB gene, AtMYB30, acts as a positive regulator of the hypersensitive cell death program in plants in response to pathogen attack. Proc. Natl. Acad. Sci. U.S.A., 2002. 99(15): p. 10179-84 [PMID:12119395] Yamada K, et al. Empirical analysis of transcriptional activity in the Arabidopsis genome. Science, 2003. 302(5646): p. 842-6 [PMID:14593172] Yanhui C, et al. The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family. Plant Mol. Biol., 2006. 60(1): p. 107-24 [PMID:16463103] Raffaele S,Rivas S,Roby D An essential role for salicylic acid in AtMYB30-mediated control of the hypersensitive cell death program in Arabidopsis. FEBS Lett., 2006. 580(14): p. 3498-504 [PMID:16730712] Raffaele S, et al. A MYB transcription factor regulates very-long-chain fatty acid biosynthesis for activation of the hypersensitive cell death response in Arabidopsis. Plant Cell, 2008. 20(3): p. 752-67 [PMID:18326828] Li L, et al. Arabidopsis MYB30 is a direct target of BES1 and cooperates with BES1 to regulate brassinosteroid-induced gene expression. Plant J., 2009. 58(2): p. 275-86 [PMID:19170933] Okada S, et al. Reconstitution of Arabidopsis thaliana SUMO pathways in E. coli: functional evaluation of SUMO machinery proteins and mapping of SUMOylation sites by mass spectrometry. Plant Cell Physiol., 2009. 50(6): p. 1049-61 [PMID:19376783] Reina-Pinto JJ, et al. Misexpression of FATTY ACID ELONGATION1 in the Arabidopsis epidermis induces cell death and suggests a critical role for phospholipase A2 in this process. Plant Cell, 2009. 21(4): p. 1252-72 [PMID:19376931] Froidure S,Roby D,Rivas S Expression of the Arabidopsis transcription factor AtMYB30 is post-transcriptionally regulated. Plant Physiol. Biochem., 2010. 48(8): p. 735-9 [PMID:20605724] Froidure S, et al. AtsPLA2-alpha nuclear relocalization by the Arabidopsis transcription factor AtMYB30 leads to repression of the plant defense response. Proc. Natl. Acad. Sci. U.S.A., 2010. 107(34): p. 15281-6 [PMID:20696912] Arabidopsis Interactome Mapping Consortium Evidence for network evolution in an Arabidopsis interactome map. Science, 2011. 333(6042): p. 601-7 [PMID:21798944] Canonne J, et al. The Xanthomonas type III effector XopD targets the Arabidopsis transcription factor MYB30 to suppress plant defense. Plant Cell, 2011. 23(9): p. 3498-511 [PMID:21917550] Bruex A, et al. A gene regulatory network for root epidermis cell differentiation in Arabidopsis. PLoS Genet., 2012. 8(1): p. e1002446 [PMID:22253603] Canonne J, et al. Identification of the protein sequence of the type III effector XopD from the B100 strain of Xanthomonas campestris pv campestris. Plant Signal Behav, 2012. 7(2): p. 184-7 [PMID:22353870] Zheng Y,Schumaker KS,Guo Y Sumoylation of transcription factor MYB30 by the small ubiquitin-like modifier E3 ligase SIZ1 mediates abscisic acid response in Arabidopsis thaliana. Proc. Natl. Acad. Sci. U.S.A., 2012. 109(31): p. 12822-7 [PMID:22814374] Marino D, et al. Arabidopsis ubiquitin ligase MIEL1 mediates degradation of the transcription factor MYB30 weakening plant defence. Nat Commun, 2013. 4: p. 1476 [PMID:23403577] Li-Beisson Y, et al. Acyl-lipid metabolism. Arabidopsis Book, 2013. 11: p. e0161 [PMID:23505340] Raffaele S,Rivas S Regulate and be regulated: integration of defense and other signals by the AtMYB30 transcription factor. Front Plant Sci, 2013. 4: p. 98 [PMID:23596456] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Tavares CP, et al. S-nitrosylation influences the structure and DNA binding activity of AtMYB30 transcription factor from Arabidopsis thaliana. Biochim. Biophys. Acta, 2014. 1844(4): p. 810-7 [PMID:24583075] Liu L, et al. Elevated levels of MYB30 in the phloem accelerate flowering in Arabidopsis through the regulation of FLOWERING LOCUS T. PLoS ONE, 2014. 9(2): p. e89799 [PMID:24587042] Xie LJ, et al. Arabidopsis acyl-CoA-binding protein ACBP3 participates in plant response to hypoxia by modulating very-long-chain fatty acid metabolism. Plant J., 2015. 81(1): p. 53-67 [PMID:25284079] Jin J, et al. An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors. Mol. Biol. Evol., 2015. 32(7): p. 1767-73 [PMID:25750178] Kaurilind E,Xu E,Brosché M A genetic framework for H2O2 induced cell death in Arabidopsis thaliana. BMC Genomics, 2015. 16: p. 837 [PMID:26493993] Lee HG,Seo PJ The Arabidopsis MIEL1 E3 ligase negatively regulates ABA signalling by promoting protein turnover of MYB96. Nat Commun, 2016. 7: p. 12525 [PMID:27615387] Serrano I, et al. A non canonical subtilase attenuates the transcriptional activation of defence responses in Arabidopsis thaliana. Elife, 2017. [PMID:27685353] Liao C,Zheng Y,Guo Y MYB30 transcription factor regulates oxidative and heat stress responses through ANNEXIN-mediated cytosolic calcium signaling in Arabidopsis. New Phytol., 2017. 216(1): p. 163-177 [PMID:28726305] Lee HG,Kim J,Suh MC,Seo PJ The MIEL1 E3 Ubiquitin Ligase Negatively Regulates Cuticular Wax Biosynthesis in Arabidopsis Stems. Plant Cell Physiol., 2017. 58(7): p. 1249-1259 [PMID:28838126] Mabuchi K, et al. MYB30 links ROS signaling, root cell elongation, and plant immune responses. Proc. Natl. Acad. Sci. U.S.A., 2018. 115(20): p. E4710-E4719 [PMID:29712840] Zheng Y,Chen Z,Ma L,Liao C The Ubiquitin E3 Ligase RHA2b Promotes Degradation of MYB30 in Abscisic Acid Signaling. Plant Physiol., 2018. 178(1): p. 428-440 [PMID:30030326]