PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSMUA_Achr8P09250_001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
|
||||||||
Family | M-type_MADS | ||||||||
Protein Properties | Length: 126aa MW: 14306.7 Da PI: 11.3652 | ||||||||
Description | M-type_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 85.5 | 3.1e-27 | 11 | 60 | 2 | 51 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 rien + rqv fskRr g++KKA+EL vLCdaeva+++fs+ gklye+ss GSMUA_Achr8P09250_001 11 RIENRISRQVRFSKRRGGLFKKAYELAVLCDAEVALVVFSPAGKLYEFSS 60 8***********************************************96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 28.973 | 2 | 62 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 1.9E-33 | 2 | 61 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 1.14E-26 | 4 | 60 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 2.02E-34 | 4 | 60 | No hit | No description |
PRINTS | PR00404 | 6.8E-29 | 4 | 24 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 1.8E-26 | 11 | 58 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 6.8E-29 | 24 | 39 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 6.8E-29 | 39 | 60 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 126 aa Download sequence Send to blast |
MAPRGRVELR RIENRISRQV RFSKRRGGLF KKAYELAVLC DAEVALVVFS PAGKLYEFSS 60 VLRRQGGRTR LPMRERERGL SVFWGRSNTA AFFSLSVDCI VVDSDLPYHF SGMCTAVLFV 120 VSRKTA |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3mu6_A | 6e-16 | 4 | 61 | 2 | 59 | Myocyte-specific enhancer factor 2A |
3mu6_B | 6e-16 | 4 | 61 | 2 | 59 | Myocyte-specific enhancer factor 2A |
3mu6_C | 6e-16 | 4 | 61 | 2 | 59 | Myocyte-specific enhancer factor 2A |
3mu6_D | 6e-16 | 4 | 61 | 2 | 59 | Myocyte-specific enhancer factor 2A |
Search in ModeBase |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009411797.1 | 2e-37 | PREDICTED: truncated transcription factor CAULIFLOWER A-like | ||||
TrEMBL | M0TNX8 | 2e-85 | M0TNX8_MUSAM; Uncharacterized protein | ||||
STRING | GSMUA_Achr8P09250_001 | 3e-86 | (Musa acuminata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP129 | 38 | 398 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G45650.1 | 4e-27 | AGAMOUS-like 6 |