 |
Plant Transcription
Factor Database
|
Transcription Factor Information
|
Basic
Information? help
Back to Top |
| TF ID |
GSMUA_Achr6P30660_001 |
| Organism |
|
| Taxonomic ID |
|
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
|
| Family |
bHLH |
| Protein Properties |
Length: 85aa MW: 9706.11 Da PI: 7.366 |
| Description |
bHLH family protein |
| Gene Model |
| Gene Model ID |
Type |
Source |
Coding Sequence |
| GSMUA_Achr6P30660_001 | genome | CIRAD | View CDS |
|
| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | HLH | 19.2 | 2.2e-06 | 12 | 51 | 15 | 54 |
HHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHH CS
HLH 15 riNsafeeLrellPkaskapskKlsKaeiLekAveYIksL 54
+i++ +++Lr llP+ ++++ + a L+++++YI sL
GSMUA_Achr6P30660_001 12 EIKELISKLRFLLPETRRQGGSRALAAKLLQETCNYIESL 51
799************66899999999************99 PP
|
| Functional Description ? help
Back to Top |
| Source |
Description |
| UniProt | Atypical and probable non DNA-binding bHLH transcription factor that acts as a positive regulator of grain size. Binds the transcription repressor APG and forms a heterodimer of antagonistic basic helix-loop-helix transcription factors that regulates grain length and weight by controlling cell elongation in lemma and palea (By similarity). {ECO:0000250}. |
| UniProt | Atypical and probable non DNA-binding bHLH transcription factor that acts as a positive regulator of grain size. Binds the transcription repressor APG and forms a heterodimer of antagonistic basic helix-loop-helix transcription factors that regulates grain length and weight by controlling cell elongation in lemma and palea. {ECO:0000269|PubMed:23136524}. |
