PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSMUA_Achr6P16560_001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 247aa MW: 27636 Da PI: 8.6705 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 156.3 | 1.3e-48 | 16 | 141 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgk 88 lppGfrFhPtdeelvv+yLk+k+ + +l++ +i+e+++ +++PwdLp + e+e yfF r+ ky++g+r+nra++sgyWkatgk GSMUA_Achr6P16560_001 16 LPPGFRFHPTDEELVVQYLKRKAFSCPLPA-AIIPEINLARLDPWDLPG---GCEEERYFFNLREAKYPRGSRSNRAARSGYWKATGK 99 79***************************9.88***************4...356899****************************** PP NAM 89 dkevlsk..kgelvglkktLvfykgrapkgektdWvmheyrl 128 dk+++s+ ++ +vg++k+Lvfy+g+ p+g+ktdW+mheyrl GSMUA_Achr6P16560_001 100 DKQITSSwcSQVVVGMRKVLVFYRGKPPTGTKTDWIMHEYRL 141 ******9988999***************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 3.66E-57 | 11 | 176 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 55.588 | 16 | 176 | IPR003441 | NAC domain |
Pfam | PF02365 | 2.3E-26 | 17 | 141 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 247 aa Download sequence Send to blast |
MDRKPSAVAR HGVLRLPPGF RFHPTDEELV VQYLKRKAFS CPLPAAIIPE INLARLDPWD 60 LPGGCEEERY FFNLREAKYP RGSRSNRAAR SGYWKATGKD KQITSSWCSQ VVVGMRKVLV 120 FYRGKPPTGT KTDWIMHEYR LAGPETRPCI FPQRKNSTHS SVDPSGDWVL CRIFRKKRAT 180 KMEVGTDEAG EEDEDPITRD GFIDFMGQRG GDQSHSTSCS SGSSCVTDHS DGSSSTGEET 240 SSSRSLP |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 8e-51 | 14 | 181 | 15 | 170 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 8e-51 | 14 | 181 | 15 | 170 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 8e-51 | 14 | 181 | 15 | 170 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 8e-51 | 14 | 181 | 15 | 170 | NO APICAL MERISTEM PROTEIN |
3swm_A | 1e-50 | 14 | 181 | 18 | 173 | NAC domain-containing protein 19 |
3swm_B | 1e-50 | 14 | 181 | 18 | 173 | NAC domain-containing protein 19 |
3swm_C | 1e-50 | 14 | 181 | 18 | 173 | NAC domain-containing protein 19 |
3swm_D | 1e-50 | 14 | 181 | 18 | 173 | NAC domain-containing protein 19 |
3swp_A | 1e-50 | 14 | 181 | 18 | 173 | NAC domain-containing protein 19 |
3swp_B | 1e-50 | 14 | 181 | 18 | 173 | NAC domain-containing protein 19 |
3swp_C | 1e-50 | 14 | 181 | 18 | 173 | NAC domain-containing protein 19 |
3swp_D | 1e-50 | 14 | 181 | 18 | 173 | NAC domain-containing protein 19 |
4dul_A | 8e-51 | 14 | 181 | 15 | 170 | NAC domain-containing protein 19 |
4dul_B | 8e-51 | 14 | 181 | 15 | 170 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional repressor that negatively regulates the expression of genes involved in xylem vessel formation. Represses the transcriptional activation activity of NAC030/VND7, which regulates protoxylem vessel differentiation by promoting immature xylem vessel-specific genes expression (PubMed:20388856). Transcriptional activator that regulates the COLD-REGULATED (COR15A and COR15B) and RESPONSIVE TO DEHYDRATION (LTI78/RD29A and LTI65/RD29B) genes by binding directly to their promoters. Mediates signaling crosstalk between salt stress response and leaf aging process (PubMed:21673078). May play a role in DNA replication of mungbean yellow mosaic virus (PubMed:24442717). {ECO:0000269|PubMed:20388856, ECO:0000269|PubMed:21673078, ECO:0000269|PubMed:24442717}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By abscisic acid (ABA) and salt stress. {ECO:0000269|PubMed:21673078}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | FM878720 | 4e-88 | FM878720.1 Musa acuminata subsp. burmannicoides var. calcutta 4 mRNA containing microsatellite, clone MAC4-59B19-F. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009404749.1 | 0.0 | PREDICTED: NAC domain-containing protein 83-like | ||||
Swissprot | Q9FY93 | 2e-72 | NAC83_ARATH; NAC domain-containing protein 83 | ||||
TrEMBL | M0T7K4 | 0.0 | M0T7K4_MUSAM; Uncharacterized protein | ||||
STRING | GSMUA_Achr6P16560_001 | 0.0 | (Musa acuminata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP6317 | 32 | 54 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G13180.1 | 2e-66 | NAC domain containing protein 83 |
Publications ? help Back to Top | |||
---|---|---|---|
|