PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSMUA_Achr6P02730_001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
|
||||||||
Family | AP2 | ||||||||
Protein Properties | Length: 165aa MW: 18461.7 Da PI: 5.8338 | ||||||||
Description | AP2 family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | AP2 | 22.9 | 2.1e-07 | 9 | 38 | 25 | 55 |
AP2 25 ngkrkrfslgkfgtaeeAakaaiaarkkleg 55 ng +++++lg++ ++e+Aa+a++ a++k++g GSMUA_Achr6P02730_001 9 NG-CASVYLGSYVSEEMAARAHDLAALKYWG 38 23.6*************************98 PP | |||||||
2 | AP2 | 56.7 | 6e-18 | 83 | 137 | 1 | 55 |
AP2 1 sgykGVrwdkkrgrWvAeIrdpseng..kr.krfslgkfgtaeeAakaaiaarkkleg 55 s y+GV++++k+g+W A+I + g k k ++lg+f+t+eeAa+a++ a+ +l+g GSMUA_Achr6P02730_001 83 SVYRGVTRRRKDGKWQARIGRV---GdlKDaKDIYLGTFDTEEEAAEAYDIAAIQLRG 137 78*****************998...664458************************997 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51032 | 11.14 | 1 | 48 | IPR001471 | AP2/ERF domain |
SMART | SM00380 | 2.1E-4 | 5 | 54 | IPR001471 | AP2/ERF domain |
Pfam | PF00847 | 1.9E-4 | 9 | 38 | IPR001471 | AP2/ERF domain |
SuperFamily | SSF54171 | 1.5E-7 | 11 | 49 | IPR016177 | DNA-binding domain |
Gene3D | G3DSA:3.30.730.10 | 1.2E-8 | 13 | 49 | IPR001471 | AP2/ERF domain |
Pfam | PF00847 | 1.3E-11 | 83 | 137 | IPR001471 | AP2/ERF domain |
SuperFamily | SSF54171 | 5.3E-18 | 83 | 147 | IPR016177 | DNA-binding domain |
CDD | cd00018 | 9.95E-22 | 83 | 147 | No hit | No description |
Gene3D | G3DSA:3.30.730.10 | 8.7E-20 | 84 | 146 | IPR001471 | AP2/ERF domain |
SMART | SM00380 | 5.6E-26 | 84 | 151 | IPR001471 | AP2/ERF domain |
PROSITE profile | PS51032 | 19.823 | 84 | 145 | IPR001471 | AP2/ERF domain |
PRINTS | PR00367 | 1.8E-5 | 85 | 96 | IPR001471 | AP2/ERF domain |
PRINTS | PR00367 | 1.8E-5 | 127 | 147 | IPR001471 | AP2/ERF domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 165 aa Download sequence Send to blast |
MIIANGCCNG CASVYLGSYV SEEMAARAHD LAALKYWGPG PATKLNFPVS DYENELENMK 60 TMSQEEFVAY VRRKSSCFSR GASVYRGVTR RRKDGKWQAR IGRVGDLKDA KDIYLGTFDT 120 EEEAAEAYDI AAIQLRGVHA VTNFDLSNYC EGGTRRPDDS FRLEM |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 71 | 92 | RRKSSCFSRGASVYRGVTRRRK |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probably acts as a transcriptional activator. Binds to the GCC-box pathogenesis-related promoter element. May be involved in the regulation of gene expression by stress factors and by components of stress signal transduction pathways (By similarity). Involved in the regulation of floral organs size. {ECO:0000250, ECO:0000269|PubMed:15988559}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009403174.1 | 1e-109 | PREDICTED: AP2-like ethylene-responsive transcription factor AIL7 isoform X1 | ||||
Refseq | XP_018683790.1 | 1e-109 | PREDICTED: AP2-like ethylene-responsive transcription factor AIL7 isoform X1 | ||||
Swissprot | Q6PQQ3 | 9e-57 | AIL5_ARATH; AP2-like ethylene-responsive transcription factor AIL5 | ||||
TrEMBL | M0T3M1 | 1e-120 | M0T3M1_MUSAM; Uncharacterized protein | ||||
STRING | GSMUA_Achr6P02730_001 | 1e-121 | (Musa acuminata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP7864 | 35 | 48 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G57390.1 | 3e-54 | AINTEGUMENTA-like 5 |
Publications ? help Back to Top | |||
---|---|---|---|
|