PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

GSMUA_Achr5P22410_001

Organism

Musa acuminata

Taxonomic ID

4641

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa

Family

MYB_related

Protein Properties

Length: 96aa MW: 11153.7 Da PI: 9.0824

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
GSMUA_Achr5P22410_001	genome	CIRAD	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	61.7	1.6e-19	14	61	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg WT eEd +l+ +++q+G+++W++I++ g+ R++k+c++rw +yl GSMUA_Achr5P22410_001 14 RGQWTLEEDNKLASYIAQHGTRNWRLIPKNAGLQRCGKSCRLRWTNYL 61 89********************************************97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	1.7E-25	5	64	IPR009057	Homeodomain-like
PROSITE profile	PS51294	25.506	9	65	IPR017930	Myb domain
SMART	SM00717	2.3E-13	13	63	IPR001005	SANT/Myb domain
Pfam	PF00249	5.1E-18	14	61	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	1.14E-22	15	88	IPR009057	Homeodomain-like
CDD	cd00167	3.27E-11	17	61	No hit	No description
Gene3D	G3DSA:1.10.10.60	2.8E-7	65	88	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 96 aa Download sequence Send to blast
MGRIPCCERE NVKRGQWTLE EDNKLASYIA QHGTRNWRLI PKNAGLQRCG KSCRLRWTNY 60 LRPDLKHGEF SEAEEQTIVK LHAVVGNRQD CETTRG

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	2e-15	11	88	4	80	B-MYB
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that binds to the DNA sequence 5'-CCAACC-3'. Regulates directly PME5, UND and GLOX1 (PubMed:21673079). Essential for tapetum development in anthers and microsporogenesis (PubMed:12848824, PubMed:21673079). Regulates the timing of tapetal programmed cell death (PCD) which is critical for pollen development. May act through the activation of UND, encoding an A1 aspartic protease (PubMed:21673079). Required for anther development by regulating tapetum development, callose dissolution and exine formation. Acts upstream of A6 and FAR2/MS2, two genes required for pollen exine formation (PubMed:17727613). Negatively regulates trichome endoreduplication and trichome branching (PubMed:12848824). {ECO:0000269\|PubMed:12848824, ECO:0000269\|PubMed:17727613, ECO:0000269\|PubMed:21673079}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_009402030.1	2e-59	PREDICTED: transcription factor MYB80
Swissprot	Q9XHV0	3e-55	MYB80_ARATH; Transcription factor MYB80
TrEMBL	M0T0R6	1e-65	M0T0R6_MUSAM; Uncharacterized protein
STRING	GSMUA_Achr5P22410_001	2e-66	(Musa acuminata)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP10867	33	39

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G56110.1	1e-57	myb domain protein 103

Publications ? help Back to Top
Li SF,Iacuone S,Parish RW Suppression and restoration of male fertility using a transcription factor. Plant Biotechnol. J., 2007. 5(2): p. 297-312 [PMID:17309685] Qian H, et al. Trace concentrations of imazethapyr (IM) affect floral organs development and reproduction in Arabidopsis thaliana: IM-induced inhibition of key genes regulating anther and pollen biosynthesis. Ecotoxicology, 2015. 24(1): p. 163-71 [PMID:25348600] Xiong SX, et al. The transcription factors MS188 and AMS form a complex to activate the expression of CYP703A2 for sporopollenin biosynthesis in Arabidopsis thaliana. Plant J., 2016. 88(6): p. 936-946 [PMID:27460657] Verma N,Burma PK Regulation of tapetum-specific A9 promoter by transcription factors AtMYB80, AtMYB1 and AtMYB4 in Arabidopsis thaliana and Nicotiana tabacum. Plant J., 2017. 92(3): p. 481-494 [PMID:28849604] Li DD,Xue JS,Zhu J,Yang ZN Gene Regulatory Network for Tapetum Development in Arabidopsis thaliana. Front Plant Sci, 2017. 8: p. 1559 [PMID:28955355]