PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AT5G56110.1

Common Name

AtMYB103, ATMYB80, MDA7.17, MS188, MYB103, MYB80

Organism

Arabidopsis thaliana

Taxonomic ID

3702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

MYB

Protein Properties

Length: 320aa MW: 35983.4 Da PI: 7.3224

Description

myb domain protein 103

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT5G56110.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	61.2	2.1e-19	14	61	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg WT+eEd +l+ +++q+G+++W++I++ g+ R++k+c++rw +yl AT5G56110.1 14 RGQWTPEEDNKLASYIAQHGTRNWRLIPKNAGLQRCGKSCRLRWTNYL 61 89********************************************97 PP
2	Myb_DNA-binding	45.7	1.6e-14	68	110	2	46
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 g +++ E+ ++v+ + lG++ W++Ia+ ++ gRt++++k++w++ AT5G56110.1 68 GQFSEAEEHIIVKFHSVLGNR-WSLIAAQLP-GRTDNDVKNYWNT 110 789****************.*****.*********97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	1.6E-25	5	64	IPR009057	Homeodomain-like
PROSITE profile	PS51294	26.472	9	65	IPR017930	Myb domain
SuperFamily	SSF46689	3.01E-29	11	108	IPR009057	Homeodomain-like
SMART	SM00717	3.2E-14	13	63	IPR001005	SANT/Myb domain
Pfam	PF00249	5.2E-18	14	61	IPR001005	SANT/Myb domain
CDD	cd00167	1.32E-11	17	61	No hit	No description
Gene3D	G3DSA:1.10.10.60	9.6E-24	65	116	IPR009057	Homeodomain-like
SMART	SM00717	3.6E-12	66	114	IPR001005	SANT/Myb domain
PROSITE profile	PS51294	19.994	66	116	IPR017930	Myb domain
Pfam	PF00249	5.7E-13	68	110	IPR001005	SANT/Myb domain
CDD	cd00167	1.77E-8	70	112	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006357	Biological Process	regulation of transcription from RNA polymerase II promoter
GO:0010090	Biological Process	trichome morphogenesis
GO:0048658	Biological Process	anther wall tapetum development
GO:0005634	Cellular Component	nucleus
GO:0000981	Molecular Function	RNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135	Molecular Function	transcription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565	Molecular Function	sequence-specific DNA binding
GO:0044212	Molecular Function	transcription regulatory region DNA binding

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0000282	anatomy	trichome
PO:0009046	anatomy	flower
PO:0009071	anatomy	anther wall tapetum
PO:0025022	anatomy	collective leaf structure
PO:0007611	developmental stage	petal differentiation and expansion stage

Sequence ? help Back to Top
Protein Sequence Length: 320 aa Download sequence Send to blast
MGRIPCCEKE NVKRGQWTPE EDNKLASYIA QHGTRNWRLI PKNAGLQRCG KSCRLRWTNY 60 LRPDLKHGQF SEAEEHIIVK FHSVLGNRWS LIAAQLPGRT DNDVKNYWNT KLKKKLSGMG 120 IDPVTHKPFS HLMAEITTTL NPPQVSHLAE AALGCFKDEM LHLLTKKRVD LNQINFSNHN 180 PNPNNFHEIA DNEAGKIKMD GLDHGNGIMK LWDMGNGFSY GSSSSSFGNE ERNDGSASPA 240 VAAWRGHGGI RTAVAETAAA EEEERRKLKG EVVDQEEIGS EGGRGDGMTM MRNHHHHQHV 300 FNVDNVLWDL QADDLINHMV

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	2e-28	14	116	7	108	B-MYB
Search in ModeBase

Expression -- Microarray ? help Back to Top
Source	ID	E-value
GEO	18423824	0.0
Genevisible	248051_at	0.0
Expression Atlas	AT5G56110	-
AtGenExpress	AT5G56110	-
ATTED-II	AT5G56110	-

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: During anther development, expressed from stage 4 to stage 6 in microsporocytes and tapetal cells. At the tetrad stage, expressed predominantly in tapetal cells. During microgametogenesis, expression decreases radically in the tapetum and microspores. {ECO:0000269\|PubMed:21957980}.
Uniprot	TISSUE SPECIFICITY: Expressed in the tapetum and middle layer of developing anthers (PubMed:10353220). Expressed in trichomes (PubMed:12848824). {ECO:0000269\|PubMed:10353220, ECO:0000269\|PubMed:12848824}.

Functional Description ? help Back to Top
Source	Description
TAIR	Encodes a member of the R2R3 MYB transcription factor gene family that is required for anther development by regulation tapetum development, callose dissolution and exine formation. It acts upstream of MS2.
UniProt	Transcription factor that binds to the DNA sequence 5'-CCAACC-3'. Regulates directly PME5, UND and GLOX1 (PubMed:21673079). Essential for tapetum development in anthers and microsporogenesis (PubMed:12848824, PubMed:21673079). Regulates the timing of tapetal programmed cell death (PCD) which is critical for pollen development. May act through the activation of UND, encoding an A1 aspartic protease (PubMed:21673079). Required for anther development by regulating tapetum development, callose dissolution and exine formation. Acts upstream of A6 and FAR2/MS2, two genes required for pollen exine formation (PubMed:17727613). Negatively regulates trichome endoreduplication and trichome branching (PubMed:12848824). {ECO:0000269\|PubMed:12848824, ECO:0000269\|PubMed:17727613, ECO:0000269\|PubMed:21673079}.

Function -- GeneRIF ? help Back to Top
These results indicate that AtMYB103 is a crucial regulator of Arabidopsis anther development. [PMID: 21104372] Data suggest that the timing of tapetal programmed cell death is critical for pollen development, and the MYB80/UNDEAD system may regulate that timing. [PMID: 21673079] DYT1, TDF1 and AMS function in early tapetum development, while MS188 and MS1 are important for late tapetum development. [PMID: 21957980] Data show that the MYB80 homolog genes, driven by the AtMYB80 or their respective promoters, rescued the atmyb80 mutant, completely restoring male fertility. [PMID: 22086333] required for FERULATE-5-HYDROXYLASE expression and syringyl lignin biosynthesis [PMID: 22967312] The MYB80 homologs fused with the EAR repressor motif have been shown to induce male sterility in Arabidopsis. [PMID: 25311582] Transcription factors (TFs) AtMYB80, AtMYB1 (positive regulators) identified by in silico analysis were found to upregulate A9 promoter activity following the over-expression of the TFs in transient and stable (transgenic) expression assays in both Arabidopsis thaliana and tobacco. [PMID: 28849604]

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00564	DAP	27203113	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT5G56110.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Regulation -- ATRM (Manually Curated Upstream Regulators) ? help Back to Top
Source	Upstream Regulator (A: Activate/R: Repress)
ATRM	AT1G32770 (A), AT1G71930 (A), AT2G46770 (A), AT3G28470 (A), AT3G61910 (A), AT5G62380 (A)

Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source	Target Gene (A: Activate/R: Repress)
ATRM	AT3G11980(A), AT5G22260(A)

Regulation -- Hormone ? help Back to Top
Source	Hormone
AHD	Brassinosteroid

Phenotype -- Disruption Phenotype ? help Back to Top
Source	Description
UniProt	DISRUPTION PHENOTYPE: Male sterility due to distorted pollen grains lacking reticulate exine on their surface. {ECO:0000269\|PubMed:17727613}.

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT5G56110

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AY519639	0.0	AY519639.1 Arabidopsis thaliana MYB transcription factor (At5g56110) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_200422.1	0.0	myb domain protein 103
Swissprot	Q9XHV0	0.0	MYB80_ARATH; Transcription factor MYB80
TrEMBL	A0A178UM75	0.0	A0A178UM75_ARATH; MYB80
STRING	AT5G56110.1	0.0	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM10005	26	35
Representative plant	OGRP5	17	1784

Link Out ? help Back to Top
Phytozome	AT5G56110.1
Entrez Gene	835710
iHOP	AT5G56110
wikigenes	AT5G56110

Publications ? help Back to Top
Li SF,Higginson T,Parish RW A novel MYB-related gene from Arabidopsis thaliana expressed in developing anthers. Plant Cell Physiol., 1999. 40(3): p. 343-7 [PMID:10353220] Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] Stracke R,Werber M,Weisshaar B The R2R3-MYB gene family in Arabidopsis thaliana. Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56 [PMID:11597504] Hanano S, et al. Analysis of gene expression in Arabidopsis thaliana by array hybridization with genomic DNA fragments aligned along chromosomal regions. Plant J., 2002. 30(2): p. 247-55 [PMID:12000460] Higginson T,Li SF,Parish RW AtMYB103 regulates tapetum and trichome development in Arabidopsis thaliana. Plant J., 2003. 35(2): p. 177-92 [PMID:12848824] Adham AR,Zolman BK,Millius A,Bartel B Mutations in Arabidopsis acyl-CoA oxidase genes reveal distinct and overlapping roles in beta-oxidation. Plant J., 2005. 41(6): p. 859-74 [PMID:15743450] Cork JM,Purugganan MD High-diversity genes in the Arabidopsis genome. Genetics, 2005. 170(4): p. 1897-911 [PMID:15911589] Yanhui C, et al. The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family. Plant Mol. Biol., 2006. 60(1): p. 107-24 [PMID:16463103] Zhang W, et al. Regulation of Arabidopsis tapetum development and function by DYSFUNCTIONAL TAPETUM1 (DYT1) encoding a putative bHLH transcription factor. Development, 2006. 133(16): p. 3085-95 [PMID:16831835] Li SF,Iacuone S,Parish RW Suppression and restoration of male fertility using a transcription factor. Plant Biotechnol. J., 2007. 5(2): p. 297-312 [PMID:17309685] Zhang ZB, et al. Transcription factor AtMYB103 is required for anther development by regulating tapetum development, callose dissolution and exine formation in Arabidopsis. Plant J., 2007. 52(3): p. 528-38 [PMID:17727613] Alves-Ferreira M, et al. Global expression profiling applied to the analysis of Arabidopsis stamen development. Plant Physiol., 2007. 145(3): p. 747-62 [PMID:17905860] Zhu J, et al. Defective in Tapetal development and function 1 is essential for anther development and tapetal function for microspore maturation in Arabidopsis. Plant J., 2008. 55(2): p. 266-77 [PMID:18397379] Zhong R,Lee C,Zhou J,McCarthy RL,Ye ZH A battery of transcription factors involved in the regulation of secondary cell wall biosynthesis in Arabidopsis. Plant Cell, 2008. 20(10): p. 2763-82 [PMID:18952777] Zhu J, et al. AtMYB103 is a crucial regulator of several pathways affecting Arabidopsis anther development. Sci China Life Sci, 2010. 53(9): p. 1112-22 [PMID:21104372] Phan HA,Iacuone S,Li SF,Parish RW The MYB80 transcription factor is required for pollen development and the regulation of tapetal programmed cell death in Arabidopsis thaliana. Plant Cell, 2011. 23(6): p. 2209-24 [PMID:21673079] Zhu J,Lou Y,Xu X,Yang ZN A genetic pathway for tapetum development and function in Arabidopsis. J Integr Plant Biol, 2011. 53(11): p. 892-900 [PMID:21957980] Phan HA,Li SF,Parish RW MYB80, a regulator of tapetal and pollen development, is functionally conserved in crops. Plant Mol. Biol., 2012. 78(1-2): p. 171-83 [PMID:22086333] MYB103 is required for FERULATE-5-HYDROXYLASE expression and syringyl lignin biosynthesis in Arabidopsis stems. Plant J., 2013. 73(1): p. 63-76 [PMID:22967312] Xu Y,Iacuone S,Li SF,Parish RW MYB80 homologues in Arabidopsis, cotton and Brassica: regulation and functional conservation in tapetal and pollen development. BMC Plant Biol., 2014. 14: p. 278 [PMID:25311582] Qian H, et al. Trace concentrations of imazethapyr (IM) affect floral organs development and reproduction in Arabidopsis thaliana: IM-induced inhibition of key genes regulating anther and pollen biosynthesis. Ecotoxicology, 2015. 24(1): p. 163-71 [PMID:25348600] Jin J, et al. An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors. Mol. Biol. Evol., 2015. 32(7): p. 1767-73 [PMID:25750178] Xiong SX, et al. The transcription factors MS188 and AMS form a complex to activate the expression of CYP703A2 for sporopollenin biosynthesis in Arabidopsis thaliana. Plant J., 2016. 88(6): p. 936-946 [PMID:27460657] Verma N,Burma PK Regulation of tapetum-specific A9 promoter by transcription factors AtMYB80, AtMYB1 and AtMYB4 in Arabidopsis thaliana and Nicotiana tabacum. Plant J., 2017. 92(3): p. 481-494 [PMID:28849604] Li DD,Xue JS,Zhu J,Yang ZN Gene Regulatory Network for Tapetum Development in Arabidopsis thaliana. Front Plant Sci, 2017. 8: p. 1559 [PMID:28955355]