PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr4P27350_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family MYB
Protein Properties Length: 300aa    MW: 33763.6 Da    PI: 4.4747
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr4P27350_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.98.4e-171764148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                           +g+W+ eEd +l+ +++++G g+W++ ++  g+ R++k+c++rw +yl
  GSMUA_Achr4P27350_001 17 KGSWSLEEDMRLIAYIEKHGHGNWRALPKLAGLLRCGKSCRLRWINYL 64
                           799*****************************99************97 PP

2Myb_DNA-binding53.84.5e-1770115148
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                            rg++T+eE++ +++++++lG++ W++Ia++++ gRt++++k+ w+++l
  GSMUA_Achr4P27350_001  70 RGNFTKEEEDAIIELHRLLGNK-WSKIASCLP-GRTDNEIKNMWNTHL 115
                            89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.7E-24867IPR009057Homeodomain-like
PROSITE profilePS5129415.0971264IPR017930Myb domain
SuperFamilySSF466892.81E-3114111IPR009057Homeodomain-like
SMARTSM007172.3E-131666IPR001005SANT/Myb domain
PfamPF002492.7E-151764IPR001005SANT/Myb domain
CDDcd001674.15E-101964No hitNo description
PROSITE profilePS5129425.69565119IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.0E-2668119IPR009057Homeodomain-like
SMARTSM007171.4E-1769117IPR001005SANT/Myb domain
PfamPF002491.7E-1570115IPR001005SANT/Myb domain
CDDcd001674.00E-1272115No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
MGRRGRAPCC DKVGLNKGSW SLEEDMRLIA YIEKHGHGNW RALPKLAGLL RCGKSCRLRW  60
INYLRPDIKR GNFTKEEEDA IIELHRLLGN KWSKIASCLP GRTDNEIKNM WNTHLKKRLA  120
SRERKSLATQ KPEDSQSSSS SSASRSCSDH GESKSDEEGN EDPSLYFTDL SVEMIEAPIG  180
PDMDMWGVAE YDTHQEEAAV IVPEFLSMME GGDYSSLIVS TGEEAMEEEE EAKGEGKSSE  240
WVEYLEKELG LCGASEENDS INQESLMRDA AEQQMEMEEE DPVSSYFHKD LVSTCPFGSC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C9e-281511925128MYB TRANSFORMING PROTEIN
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that regulates positively genes involved in anthocyanin biosynthesis such as A1. {ECO:0000269|PubMed:7920701}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009397824.10.0PREDICTED: myb-related protein Zm1-like
SwissprotP200248e-80MYB1_MAIZE; Myb-related protein Zm1
TrEMBLM0SSJ70.0M0SSJ7_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr4P27350_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP21543798
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G56160.11e-66myb domain protein 72
Publications ? help Back to Top
  1. Franken P,Schrell S,Peterson PA,Saedler H,Wienand U
    Molecular analysis of protein domain function encoded by the myb-homologous maize genes C1, Zm 1 and Zm 38.
    Plant J., 1994. 6(1): p. 21-30
    [PMID:7920701]