PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AT1G56160.1

Common Name

ATMYB72, F14G9.22, MYB72, T6H22.4

Organism

Arabidopsis thaliana

Taxonomic ID

3702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

MYB

Protein Properties

Length: 296aa MW: 34106.6 Da PI: 5.9187

Description

myb domain protein 72

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT1G56160.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	50.1	6.3e-16	16	63	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+W+++Ed+ l+ ++++G +W++ ++ g+ R++k+c++rw +yl AT1G56160.1 16 RGPWSPQEDLTLITFIQKHGHQNWRSLPKLAGLLRCGKSCRLRWINYL 63 89****************************99**********97 PP
2	Myb_DNA-binding	46.7	7.2e-15	69	114	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg++++ E++ ++++++ lG++ W++Ia+ ++ gRt++++k+ w+++l AT1G56160.1 69 RGNFSKKEEDAIIHYHQTLGNK-WSKIASFLP-GRTDNEIKNVWNTHL 114 89******************.*****.**********986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	1.1E-23	7	66	IPR009057	Homeodomain-like
PROSITE profile	PS51294	15.976	11	63	IPR017930	Myb domain
SuperFamily	SSF46689	5.5E-29	14	110	IPR009057	Homeodomain-like
SMART	SM00717	1.8E-12	15	65	IPR001005	SANT/Myb domain
Pfam	PF00249	4.9E-15	16	63	IPR001005	SANT/Myb domain
CDD	cd00167	2.61E-9	18	63	No hit	No description
PROSITE profile	PS51294	23.047	64	118	IPR017930	Myb domain
Gene3D	G3DSA:1.10.10.60	1.2E-25	67	118	IPR009057	Homeodomain-like
SMART	SM00717	1.8E-13	68	116	IPR001005	SANT/Myb domain
Pfam	PF00249	7.6E-14	69	114	IPR001005	SANT/Myb domain
CDD	cd00167	2.34E-9	71	114	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006357	Biological Process	regulation of transcription from RNA polymerase II promoter
GO:0009866	Biological Process	induced systemic resistance, ethylene mediated signaling pathway
GO:0030154	Biological Process	cell differentiation
GO:0071281	Biological Process	cellular response to iron ion
GO:0071732	Biological Process	cellular response to nitric oxide
GO:0005634	Cellular Component	nucleus
GO:0000981	Molecular Function	RNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135	Molecular Function	transcription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565	Molecular Function	sequence-specific DNA binding
GO:0044212	Molecular Function	transcription regulatory region DNA binding

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0009046	anatomy	flower
PO:0007616	developmental stage	flowering stage

Sequence ? help Back to Top
Protein Sequence Length: 296 aa Download sequence Send to blast
MGKGRAPCCD KNKVKRGPWS PQEDLTLITF IQKHGHQNWR SLPKLAGLLR CGKSCRLRWI 60 NYLRPDVKRG NFSKKEEDAI IHYHQTLGNK WSKIASFLPG RTDNEIKNVW NTHLKKRLTP 120 SSSSSSLSST HDQSTKADHD KNCDGAQEEI HSGLNESQNS ATSSHHQGEC MHTKPELHEV 180 NGLNEIQFLL DHDDFDDITS EFLQDNDILF PLDSLLHNHQ THISTQEMTR EVTKSQSFDH 240 PQPDIPCGFE DTNEESDLRR QLVESTTPNN EYDEWFNFID NQTYFDDFNF VGEVCL

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	9e-26	16	118	7	108	B-MYB
1gv2_A	9e-26	16	118	4	105	MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase

Expression -- Microarray ? help Back to Top
Source	ID	E-value
GEO	18405711	0.0
Genevisible	262091_at	0.0
Expression Atlas	AT1G56160	-
AtGenExpress	AT1G56160	-

Functional Description ? help Back to Top
Source	Description
TAIR	Encodes a member of the R2R3 transcription factor gene family that is involved in mediating induced systemic resistance. Genetic analysis of loss of function mutants and overexpressor lines indicates MYB72 is necessary but not sufficient for ISR.Interacts in vivo with EIL3.
UniProt	Involved in metal ions homeostasis, including iron ions (Fe) acquisition, via the regulation of NAS4 and NAS2 genes expression. Necessary for plant survival in alkaline soil where iron availability is greatly restricted (PubMed:18088336, PubMed:24278034). Involved in the up-regulation of several biosynthesis genes of secondary metabolites involved in iron uptake under conditions of iron deficiency (PubMed:25138267). Triggers tolerance to nickel (Ni) and zinc (Zn) ions (PubMed:24278034). Required in the roots during early signaling steps of rhizobacteria-mediated (e.g. P.fluorescens WCS417r) and beneficial fungi-mediated (e.g. T.asperellum T34) broad-spectrum induced systemic resistance (ISR) against several pathogens (e.g. P.syringae pv tomato, H.parasitica, P.cucumerina, A.brassicicola and B.cinerea) and implying enhanced callose deposition (PubMed:18218967, PubMed:19121118). Required for the induction of some genes (e.g. BGLU42) upon rhizobacteria-mediated ISR (PubMed:25138267). {ECO:0000269\|PubMed:18088336, ECO:0000269\|PubMed:18218967, ECO:0000269\|PubMed:19121118, ECO:0000269\|PubMed:24278034, ECO:0000269\|PubMed:25138267}.

Function -- GeneRIF ? help Back to Top
induced systemic resistance (ISR) signaling component that is required in the roots during early signaling steps of rhizobacteria-mediated ISR [PMID: 18218967] MYB72 functions as an early node of convergence in the signalling pathways that are induced by different beneficial microorganisms [PMID: 19121118] our results provide evidence that MYB10 and MYB72 act early in the iron-deficiency regulatory cascade to drive gene expression of NAS4 and are essential for plant survival under iron deficiency [PMID: 24278034] MYB72 regulates the expression of genes associated with the production of iron mobilizing phenolic metabolites, and that BGLU42 plays an important role in the secretion of these compounds in the root vicinity. [PMID: 25138267] Investigated myb domain protein 72's (MYB72) role in the root microbiome; results suggest probiotic rhizobacteria that activate the iron-deficiency response during colonization stimulate MYB72-dependent excretion of scopoletin, possibly improving their niche establishment and enhancing plant growth and protection. [PMID: 29686086]

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT1G56160.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Accumulates strongly in the root stele when exposed to iron (Fe)-deficient conditions (PubMed:24278034). Accumulates upon potassium ion (K) depletion (PubMed:15489280). Induced in roots by zinc (Zn) and cadmium (Cd) ions (PubMed:18088336). Specifically activated in the roots upon colonization by nonpathogenic P.fluorescens WCS417r (PubMed:18218967). {ECO:0000269\|PubMed:15489280, ECO:0000269\|PubMed:18088336, ECO:0000269\|PubMed:18218967, ECO:0000269\|PubMed:24278034}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Regulation -- Hormone ? help Back to Top
Source	Hormone
AHD	ethylene

Interaction ? help Back to Top
Source	Intact With
BioGRID	AT1G73730

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT1G56160

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AF062905	0.0	AF062905.1 Arabidopsis thaliana putative transcription factor (MYB72) mRNA, partial cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_176012.1	0.0	myb domain protein 72
Swissprot	Q9SGU3	0.0	MYB72_ARATH; Transcription factor MYB72
TrEMBL	A0A178W4I7	0.0	A0A178W4I7_ARATH; MYB72
STRING	AT1G56160.1	0.0	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM4	28	2646
Representative plant	OGRP5	17	1784

Link Out ? help Back to Top
Phytozome	AT1G56160.1
Entrez Gene	842069
iHOP	AT1G56160
wikigenes	AT1G56160

Publications ? help Back to Top
Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] Stracke R,Werber M,Weisshaar B The R2R3-MYB gene family in Arabidopsis thaliana. Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56 [PMID:11597504] Jiao Y, et al. A genome-wide analysis of blue-light regulation of Arabidopsis transcription factor gene expression during seedling development. Plant Physiol., 2003. 133(4): p. 1480-93 [PMID:14605227] Zhang S, et al. Resources for targeted insertional and deletional mutagenesis in Arabidopsis. Plant Mol. Biol., 2003. 53(1-2): p. 133-50 [PMID:14756312] Hampton CR, et al. Cesium toxicity in Arabidopsis. Plant Physiol., 2004. 136(3): p. 3824-37 [PMID:15489280] Colangelo EP,Guerinot ML The essential basic helix-loop-helix protein FIT1 is required for the iron deficiency response. Plant Cell, 2004. 16(12): p. 3400-12 [PMID:15539473] Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] van de Mortel JE, et al. Large expression differences in genes for iron and zinc homeostasis, stress response, and lignin biosynthesis distinguish roots of Arabidopsis thaliana and the related metal hyperaccumulator Thlaspi caerulescens. Plant Physiol., 2006. 142(3): p. 1127-47 [PMID:16998091] Van der Ent S, et al. MYB72 is required in early signaling steps of rhizobacteria-induced systemic resistance in Arabidopsis. Plant Physiol., 2008. 146(3): p. 1293-304 [PMID:18218967] Yang TJ,Perry PJ,Ciani S,Pandian S,Schmidt W Manganese deficiency alters the patterning and development of root hairs in Arabidopsis. J. Exp. Bot., 2008. 59(12): p. 3453-64 [PMID:18772308] Segarra G,Van der Ent S,Trillas I,Pieterse CM MYB72, a node of convergence in induced systemic resistance triggered by a fungal and a bacterial beneficial microbe. Plant Biol (Stuttg), 2009. 11(1): p. 90-6 [PMID:19121118] Garc Ethylene and nitric oxide involvement in the up-regulation of key genes related to iron acquisition and homeostasis in Arabidopsis. J. Exp. Bot., 2010. 61(14): p. 3885-99 [PMID:20627899] Palmer CM,Hindt MN,Schmidt H,Clemens S,Guerinot ML MYB10 and MYB72 are required for growth under iron-limiting conditions. PLoS Genet., 2013. 9(11): p. e1003953 [PMID:24278034] Zamioudis C,Hanson J,Pieterse CM β-Glucosidase BGLU42 is a MYB72-dependent key regulator of rhizobacteria-induced systemic resistance and modulates iron deficiency responses in Arabidopsis roots. New Phytol., 2014. 204(2): p. 368-79 [PMID:25138267] Zamioudis C, et al. Rhizobacterial volatiles and photosynthesis-related signals coordinate MYB72 expression in Arabidopsis roots during onset of induced systemic resistance and iron-deficiency responses. Plant J., 2015. 84(2): p. 309-22 [PMID:26307542] Zhou C, et al. Paenibacillus polymyxa BFKC01 enhances plant iron absorption via improved root systems and activated iron acquisition mechanisms. Plant Physiol. Biochem., 2016. 105: p. 162-173 [PMID:27105423] Wang C,Yao X,Yu D,Liang G Fe-deficiency-induced expression of bHLH104 enhances Fe-deficiency tolerance of Arabidopsis thaliana. Planta, 2017. 246(3): p. 421-431 [PMID:28451750] Martínez-Medina A,Van Wees SCM,Pieterse CMJ Airborne signals from Trichoderma fungi stimulate iron uptake responses in roots resulting in priming of jasmonic acid-dependent defences in shoots of Arabidopsis thaliana and Solanum lycopersicum. Plant Cell Environ., 2017. 40(11): p. 2691-2705 [PMID:28667819] Stringlis IA, et al. MYB72-dependent coumarin exudation shapes root microbiome assembly to promote plant health. Proc. Natl. Acad. Sci. U.S.A., 2018. 115(22): p. E5213-E5222 [PMID:29686086] Kranz HD, et al. Towards functional characterisation of the members of the R2R3-MYB gene family from Arabidopsis thaliana. Plant J., 1998. 16(2): p. 263-76 [PMID:9839469]