PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSMUA_Achr3P01580_001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
|
||||||||
Family | bHLH | ||||||||
Protein Properties | Length: 92aa MW: 10237.8 Da PI: 7.5246 | ||||||||
Description | bHLH family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | HLH | 23.5 | 1e-07 | 20 | 59 | 15 | 54 |
HHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHH CS HLH 15 riNsafeeLrellPkaskapskKlsKaeiLekAveYIksL 54 +iN+ +++L+ +lP+a + + ++s a +L++++ Y++sL GSMUA_Achr3P01580_001 20 QINDLMAKLQAVLPEARLGINHRVSAARVLQETCSYLRSL 59 8**************889********************99 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50888 | 9.737 | 5 | 59 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
Gene3D | G3DSA:4.10.280.10 | 4.9E-8 | 19 | 74 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
SuperFamily | SSF47459 | 1.7E-9 | 19 | 77 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
Pfam | PF00010 | 6.1E-5 | 20 | 59 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 92 aa Download sequence Send to blast |
MSGRRSRSRQ SMSPSITDEQ INDLMAKLQA VLPEARLGIN HRVSAARVLQ ETCSYLRSLH 60 REVDDLSERL SELLAMADIS GAEAAIIRSL LM |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Atypical and probable non DNA-binding bHLH transcription factor that integrates multiple signaling pathways to regulate cell elongation and plant development. {ECO:0000250}. | |||||
UniProt | Atypical and probable non DNA-binding bHLH transcription factor that integrates multiple signaling pathways to regulate cell elongation and plant development. {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009390918.1 | 6e-59 | PREDICTED: transcription factor ILI6-like | ||||
Swissprot | A2Z730 | 6e-36 | ILI7_ORYSI; Transcription factor ILI7 | ||||
Swissprot | Q338G6 | 6e-36 | ILI7_ORYSJ; Transcription factor ILI7 | ||||
TrEMBL | M0SAX6 | 1e-57 | M0SAX6_MUSAM; Uncharacterized protein | ||||
STRING | GSMUA_Achr3P01580_001 | 2e-58 | (Musa acuminata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP2675 | 33 | 78 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G26945.1 | 8e-30 | bHLH family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|