PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSMUA_Achr10P16940_001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 218aa MW: 24836.1 Da PI: 7.9725 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 131.6 | 5.8e-41 | 14 | 136 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatg 87 lppGfrFhPtdeelvv+yLk+kv + +l++ ++i+e+d+ +++PwdLp ++e+ y Fs r+ +y + +r+n ++sg Wk g GSMUA_Achr10P16940_001 14 LPPGFRFHPTDEELVVQYLKRKVYSFPLPA-SIIPEIDLRNHDPWDLP---GGREEVRYLFSFREATYLNRNRSNPRARSGCWKVAG 96 79****************************.89***************...3455677*****************999********* PP NAM 88 kdkevlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128 k+++v+++ +++vg+kk+Lvfy+g+ p+ +tdW+mheyrl GSMUA_Achr10P16940_001 97 KERQVVASgCNQVVGMKKVLVFYRGKPPT--RTDWIMHEYRL 136 ******9977889**********999998..9********98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 4.97E-50 | 7 | 166 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 49.07 | 14 | 166 | IPR003441 | NAC domain |
Pfam | PF02365 | 2.4E-24 | 15 | 136 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 218 aa Download sequence Send to blast |
MDNTGFVRHG MLRLPPGFRF HPTDEELVVQ YLKRKVYSFP LPASIIPEID LRNHDPWDLP 60 GGREEVRYLF SFREATYLNR NRSNPRARSG CWKVAGKERQ VVASGCNQVV GMKKVLVFYR 120 GKPPTRTDWI MHEYRLARPD ANPRNDATHS SMVPNGDWVL CRIFRKKRAA KMEAEEDDEQ 180 AGEQMMRMGD DGSSCVTELP DVSSDGEEAS SSSMSSPP |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 2e-41 | 12 | 171 | 15 | 170 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 2e-41 | 12 | 171 | 15 | 170 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 2e-41 | 12 | 171 | 15 | 170 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 2e-41 | 12 | 171 | 15 | 170 | NO APICAL MERISTEM PROTEIN |
3swm_A | 2e-41 | 12 | 171 | 18 | 173 | NAC domain-containing protein 19 |
3swm_B | 2e-41 | 12 | 171 | 18 | 173 | NAC domain-containing protein 19 |
3swm_C | 2e-41 | 12 | 171 | 18 | 173 | NAC domain-containing protein 19 |
3swm_D | 2e-41 | 12 | 171 | 18 | 173 | NAC domain-containing protein 19 |
3swp_A | 2e-41 | 12 | 171 | 18 | 173 | NAC domain-containing protein 19 |
3swp_B | 2e-41 | 12 | 171 | 18 | 173 | NAC domain-containing protein 19 |
3swp_C | 2e-41 | 12 | 171 | 18 | 173 | NAC domain-containing protein 19 |
3swp_D | 2e-41 | 12 | 171 | 18 | 173 | NAC domain-containing protein 19 |
4dul_A | 2e-41 | 12 | 171 | 15 | 170 | NAC domain-containing protein 19 |
4dul_B | 2e-41 | 12 | 171 | 15 | 170 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional repressor that negatively regulates the expression of genes involved in xylem vessel formation. Represses the transcriptional activation activity of NAC030/VND7, which regulates protoxylem vessel differentiation by promoting immature xylem vessel-specific genes expression (PubMed:20388856). Transcriptional activator that regulates the COLD-REGULATED (COR15A and COR15B) and RESPONSIVE TO DEHYDRATION (LTI78/RD29A and LTI65/RD29B) genes by binding directly to their promoters. Mediates signaling crosstalk between salt stress response and leaf aging process (PubMed:21673078). May play a role in DNA replication of mungbean yellow mosaic virus (PubMed:24442717). {ECO:0000269|PubMed:20388856, ECO:0000269|PubMed:21673078, ECO:0000269|PubMed:24442717}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By abscisic acid (ABA) and salt stress. {ECO:0000269|PubMed:21673078}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009379969.1 | 1e-163 | PREDICTED: NAC domain-containing protein 83-like | ||||
Swissprot | Q9FY93 | 2e-68 | NAC83_ARATH; NAC domain-containing protein 83 | ||||
TrEMBL | M0RIW9 | 1e-162 | M0RIW9_MUSAM; Uncharacterized protein | ||||
STRING | GSMUA_Achr10P16940_001 | 1e-163 | (Musa acuminata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP8233 | 30 | 47 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G13180.1 | 9e-70 | NAC domain containing protein 83 |
Publications ? help Back to Top | |||
---|---|---|---|
|