PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Lus10041924 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 204aa MW: 23597.6 Da PI: 9.5129 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 181.4 | 2.2e-56 | 44 | 172 | 1 | 129 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kg 97 lppGfrFhPtdeel+++yL kkv +++++ ++i+evd++k+ePw+Lp+k+k +ekewyfFs rd+ky+tg r+nrat++gyWkatgkd+e++s+ + Lus10041924 44 LPPGFRFHPTDEELITYYLLKKVMDSSFSG-RAIAEVDLNKCEPWHLPEKAKMGEKEWYFFSLRDRKYPTGLRTNRATEAGYWKATGKDREIYSSkSC 140 79*************************999.89***************99999****************************************98455 PP NAM 98 elvglkktLvfykgrapkgektdWvmheyrle 129 +lvg+kktLvfy+grapkgek++Wvmheyrle Lus10041924 141 ALVGMKKTLVFYRGRAPKGEKSNWVMHEYRLE 172 67****************************85 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 1.12E-60 | 38 | 180 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 55.516 | 44 | 186 | IPR003441 | NAC domain |
Pfam | PF02365 | 2.3E-29 | 45 | 171 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 204 aa Download sequence Send to blast |
MDPHPFHPCF PYSNPPPSTD YTTTANFNYT SSANHHQQNQ TTNLPPGFRF HPTDEELITY 60 YLLKKVMDSS FSGRAIAEVD LNKCEPWHLP EKAKMGEKEW YFFSLRDRKY PTGLRTNRAT 120 EAGYWKATGK DREIYSSKSC ALVGMKKTLV FYRGRAPKGE KSNWVMHEYR LEGKFSYHFL 180 SRSSKVSTTS YLSFTCERGN AWL* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 1e-51 | 43 | 171 | 16 | 142 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 1e-51 | 43 | 171 | 16 | 142 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 1e-51 | 43 | 171 | 16 | 142 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 1e-51 | 43 | 171 | 16 | 142 | NO APICAL MERISTEM PROTEIN |
3swm_A | 1e-51 | 43 | 171 | 19 | 145 | NAC domain-containing protein 19 |
3swm_B | 1e-51 | 43 | 171 | 19 | 145 | NAC domain-containing protein 19 |
3swm_C | 1e-51 | 43 | 171 | 19 | 145 | NAC domain-containing protein 19 |
3swm_D | 1e-51 | 43 | 171 | 19 | 145 | NAC domain-containing protein 19 |
3swp_A | 1e-51 | 43 | 171 | 19 | 145 | NAC domain-containing protein 19 |
3swp_B | 1e-51 | 43 | 171 | 19 | 145 | NAC domain-containing protein 19 |
3swp_C | 1e-51 | 43 | 171 | 19 | 145 | NAC domain-containing protein 19 |
3swp_D | 1e-51 | 43 | 171 | 19 | 145 | NAC domain-containing protein 19 |
4dul_A | 1e-51 | 43 | 171 | 16 | 142 | NAC domain-containing protein 19 |
4dul_B | 1e-51 | 43 | 171 | 16 | 142 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator of STM and KNAT6. Involved in molecular mechanisms regulating shoot apical meristem (SAM) formation during embryogenesis and organ separation. Required for the fusion of septa of gynoecia along the length of the ovaries. Activates the shoot formation in callus in a STM-dependent manner. Controls leaf margin development and required for leaf serration. Involved in axillary meristem initiation and separation of the meristem from the main stem. Regulates the phyllotaxy throughout the plant development. Seems to act as an inhibitor of cell division. {ECO:0000269|PubMed:10079219, ECO:0000269|PubMed:10750709, ECO:0000269|PubMed:12163400, ECO:0000269|PubMed:12492830, ECO:0000269|PubMed:12610213, ECO:0000269|PubMed:15202996, ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:15500463, ECO:0000269|PubMed:15723790, ECO:0000269|PubMed:16798887, ECO:0000269|PubMed:17098808, ECO:0000269|PubMed:17122068, ECO:0000269|PubMed:17251269, ECO:0000269|PubMed:17287247, ECO:0000269|PubMed:9212461}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Lus10041924 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By BRM and SYD, at the chromatin level, and conferring a very specific spatial expression pattern. Precise spatial regulation by post-transcriptional repression directed by the microRNA miR164. {ECO:0000269|PubMed:15202996, ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:15723790, ECO:0000269|PubMed:16854978, ECO:0000269|PubMed:17251269, ECO:0000269|PubMed:17287247}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HQ886188 | 1e-103 | HQ886188.1 Linum usitatissimum clone Contig2138 microsatellite sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_017618665.1 | 1e-100 | PREDICTED: protein CUP-SHAPED COTYLEDON 2-like isoform X1 | ||||
Refseq | XP_017618666.1 | 1e-100 | PREDICTED: protein CUP-SHAPED COTYLEDON 2-like isoform X1 | ||||
Swissprot | O04017 | 1e-93 | NAC98_ARATH; Protein CUP-SHAPED COTYLEDON 2 | ||||
TrEMBL | A5AU94 | 5e-99 | A5AU94_VITVI; Uncharacterized protein | ||||
STRING | Lus10041924 | 1e-152 | (Linum usitatissimum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF3689 | 34 | 63 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G53950.1 | 5e-96 | NAC family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Lus10041924 |