PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Lus10038822 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 86aa MW: 9938.14 Da PI: 5.6533 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 31.3 | 4.8e-10 | 31 | 71 | 3 | 45 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 r+T++E++l+ + ++ G++ W++Ia +++ gR+++++ +w Lus10038822 31 RMTEQEEDLIFRMYRLVGKR-WDLIAGRIP-GRSAEEIERFWI 71 89******************.*********.*********995 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00717 | 1.5E-7 | 28 | 76 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 2.00E-6 | 31 | 70 | No hit | No description |
Pfam | PF00249 | 6.2E-9 | 31 | 71 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS50090 | 6.226 | 33 | 70 | IPR017877 | Myb-like domain |
Gene3D | G3DSA:1.10.10.60 | 1.4E-10 | 33 | 71 | IPR009057 | Homeodomain-like |
SuperFamily | SSF46689 | 7.26E-8 | 33 | 72 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 86 aa Download sequence Send to blast |
MGSWSKADDK DSISSSSVSQ EVSSREWEVV RMTEQEEDLI FRMYRLVGKR WDLIAGRIPG 60 RSAEEIERFW IMKHHGKTNV DDHAL* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Involved in epidermal cell fate specification. Negative regulator of trichome development, including endoreplication, by lateral inhibition involving intercellular interactions. Promotes the formation of hair developing cells (trichoblasts) in H position in root epidermis, probably by inhibiting non-hair cell (atrichoblasts) formation. {ECO:0000269|PubMed:10368181, ECO:0000269|PubMed:12356720}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Lus10038822 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Negative autoregulation. Repressed by CPC. {ECO:0000269|PubMed:12356720}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018812764.1 | 1e-28 | PREDICTED: transcription factor TRY-like isoform X1 | ||||
Refseq | XP_018815540.1 | 7e-29 | PREDICTED: transcription factor CPC-like isoform X2 | ||||
Swissprot | Q8GV05 | 1e-26 | TRY_ARATH; Transcription factor TRY | ||||
TrEMBL | A0A2I4E040 | 3e-27 | A0A2I4E040_JUGRE; transcription factor TRY-like isoform X1 | ||||
TrEMBL | A0A2I4E811 | 2e-27 | A0A2I4E811_JUGRE; transcription factor CPC-like isoform X2 | ||||
STRING | Lus10038822 | 2e-55 | (Linum usitatissimum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF3583 | 27 | 57 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G01380.1 | 8e-24 | MYB_related family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Lus10038822 |