PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Lus10033061 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
|
||||||||
Family | GRAS | ||||||||
Protein Properties | Length: 130aa MW: 14074 Da PI: 4.7303 | ||||||||
Description | GRAS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GRAS | 123.6 | 2.3e-38 | 1 | 106 | 267 | 374 |
GRAS 267 lfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkd 364 +fdsl+a + + +++ v ++++++ei+nvv+ceg++r erhe l+kWrerl+eaGFkp++l+++a kqa++ll ++ +gy+vee +g+l+lgW++ Lus10033061 1 MFDSLDAC--SIQAAEKAVAEMYIQKEICNVVSCEGSARLERHEPLSKWRERLNEAGFKPLHLGSNAFKQASMLLTLFSAEGYSVEETDGCLTLGWHS 96 79***887..4567778888899*************************************************************************** PP GRAS 365 rpLvsvSaWr 374 rpL+++SaW+ Lus10033061 97 RPLIAASAWQ 106 *********6 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50985 | 15.752 | 1 | 86 | IPR005202 | Transcription factor GRAS |
Pfam | PF03514 | 7.8E-36 | 1 | 106 | IPR005202 | Transcription factor GRAS |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 130 aa Download sequence Send to blast |
MFDSLDACSI QAAEKAVAEM YIQKEICNVV SCEGSARLER HEPLSKWRER LNEAGFKPLH 60 LGSNAFKQAS MLLTLFSAEG YSVEETDGCL TLGWHSRPLI AASAWQALPE IPVPDIAVVN 120 ERNGGAGLL* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5b3g_A | 4e-16 | 1 | 105 | 273 | 378 | Protein SCARECROW |
5b3h_A | 4e-16 | 1 | 105 | 272 | 377 | Protein SCARECROW |
5b3h_D | 4e-16 | 1 | 105 | 272 | 377 | Protein SCARECROW |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcriptional regulator that acts as a repressor of the gibberellin (GA) signaling pathway. Probably acts by participating in large multiprotein complexes that represses transcription of GA-inducible genes. Upon GA application, it is degraded by the proteasome, allowing the GA signaling pathway (By similarity). {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Lus10033061 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002529354.1 | 2e-61 | DELLA protein SLN1 | ||||
Swissprot | Q6EI06 | 1e-42 | GAIP_CUCMA; DELLA protein GAIP | ||||
TrEMBL | B9STN5 | 5e-60 | B9STN5_RICCO; DELLA protein GAI1, putative | ||||
STRING | Lus10017758 | 4e-87 | (Linum usitatissimum) | ||||
STRING | Lus10033061 | 3e-91 | (Linum usitatissimum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF803 | 34 | 121 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G14920.1 | 2e-42 | GRAS family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Lus10033061 |