PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Lus10029908 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 142aa MW: 15851.7 Da PI: 8.0907 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 156.5 | 4.4e-49 | 5 | 98 | 4 | 97 |
NF-YB 4 qdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 qdr++Pianv+rimk+vlP akisk+ak+tvqec++efisfvtsea+dkc++e+rkt+ngdd++wal++lGf++y++++ yl+kyr +e+ek Lus10029908 5 QDRLVPIANVGRIMKQVLPPTAKISKEAKQTVQECATEFISFVTSEAADKCHKENRKTVNGDDICWALSNLGFDHYADAIVRYLHKYRMAEREK 98 9******************************************************************************************997 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 2.2E-47 | 3 | 113 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 2.8E-38 | 5 | 119 | IPR009072 | Histone-fold |
Pfam | PF00808 | 2.9E-26 | 9 | 72 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 4.0E-17 | 36 | 54 | No hit | No description |
PRINTS | PR00615 | 4.0E-17 | 55 | 73 | No hit | No description |
PRINTS | PR00615 | 4.0E-17 | 74 | 92 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 142 aa Download sequence Send to blast |
MDEVQDRLVP IANVGRIMKQ VLPPTAKISK EAKQTVQECA TEFISFVTSE AADKCHKENR 60 KTVNGDDICW ALSNLGFDHY ADAIVRYLHK YRMAEREKAS TSQDRSSNHQ SRQPEHLRGA 120 ATSFEFRVLE KGNSSSPANP S* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 1e-38 | 5 | 92 | 4 | 91 | Transcription factor HapC (Eurofung) |
4g92_B | 1e-38 | 5 | 92 | 4 | 91 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Lus10029908 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011023651.1 | 1e-71 | PREDICTED: nuclear transcription factor Y subunit B-4-like | ||||
Swissprot | O04027 | 6e-58 | NFYB4_ARATH; Nuclear transcription factor Y subunit B-4 | ||||
TrEMBL | B9I7Q3 | 5e-69 | B9I7Q3_POPTR; Uncharacterized protein | ||||
STRING | Lus10029908 | 1e-103 | (Linum usitatissimum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF805 | 32 | 131 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G09030.1 | 3e-60 | nuclear factor Y, subunit B4 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Lus10029908 |
Publications ? help Back to Top | |||
---|---|---|---|
|