PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Lus10007983 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 266aa MW: 30042.9 Da PI: 8.7539 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 95.6 | 2.2e-30 | 10 | 59 | 2 | 51 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 rienk+nrqvtfskRr g+lKKA+E+SvLCdaeva+i+fs++gkl+eys+ Lus10007983 10 RIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSTKGKLFEYST 59 8***********************************************96 PP | |||||||
2 | K-box | 102.8 | 4.4e-34 | 79 | 174 | 5 | 100 |
K-box 5 sgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100 + ++++++ s++ e+akLk++ie Lq+++R++ G+dL+sLsl+eLq+LeqqL+++lk+iRs+Kn+l++e+i+elqkk k+lq++n++L kk++e Lus10007983 79 QLLANDTETCGSWTLEYAKLKARIEVLQKNLRNYNGQDLDSLSLRELQNLEQQLDSALKHIRSRKNQLMYESISELQKKDKALQDQNNQLAKKVKE 174 555567778899*********************************************************************************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 32.394 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 2.0E-39 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.36E-41 | 2 | 79 | No hit | No description |
SuperFamily | SSF55455 | 1.31E-33 | 2 | 88 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 6.3E-31 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 2.8E-25 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 6.3E-31 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 6.3E-31 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS51297 | 16.677 | 88 | 178 | IPR002487 | Transcription factor, K-box |
Pfam | PF01486 | 1.8E-27 | 90 | 172 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0010077 | Biological Process | maintenance of inflorescence meristem identity | ||||
GO:0010154 | Biological Process | fruit development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 266 aa Download sequence Send to blast |
MGRGRVQLRR IENKINRQVT FSKRRSGLLK KAHEISVLCD AEVALIVFST KGKLFEYSTD 60 SCMERILERY ERYSYAERQL LANDTETCGS WTLEYAKLKA RIEVLQKNLR NYNGQDLDSL 120 SLRELQNLEQ QLDSALKHIR SRKNQLMYES ISELQKKDKA LQDQNNQLAK KVKEREKEIL 180 EQPQWEQQQD PPSLVTQQME DSPSSIVVAP QPFQPLDISG GSGGGGGGGY QLARGNTGVE 240 EGTSSSSSQH RPSAVLPSWM MGNHI* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1tqe_P | 6e-22 | 1 | 74 | 1 | 73 | Myocyte-specific enhancer factor 2B |
1tqe_Q | 6e-22 | 1 | 74 | 1 | 73 | Myocyte-specific enhancer factor 2B |
1tqe_R | 6e-22 | 1 | 74 | 1 | 73 | Myocyte-specific enhancer factor 2B |
1tqe_S | 6e-22 | 1 | 74 | 1 | 73 | Myocyte-specific enhancer factor 2B |
5f28_C | 7e-22 | 1 | 74 | 1 | 73 | MEF2C |
5f28_D | 7e-22 | 1 | 74 | 1 | 73 | MEF2C |
6byy_A | 6e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6byy_B | 6e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6byy_C | 6e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6byy_D | 6e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6bz1_A | 7e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6bz1_B | 7e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6bz1_C | 7e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6bz1_D | 7e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6c9l_A | 6e-22 | 1 | 74 | 1 | 73 | Myocyte-specific enhancer factor 2B |
6c9l_B | 6e-22 | 1 | 74 | 1 | 73 | Myocyte-specific enhancer factor 2B |
6c9l_C | 6e-22 | 1 | 74 | 1 | 73 | Myocyte-specific enhancer factor 2B |
6c9l_D | 6e-22 | 1 | 74 | 1 | 73 | Myocyte-specific enhancer factor 2B |
6c9l_E | 6e-22 | 1 | 74 | 1 | 73 | Myocyte-specific enhancer factor 2B |
6c9l_F | 6e-22 | 1 | 74 | 1 | 73 | Myocyte-specific enhancer factor 2B |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Lus10007983 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_008393256.1 | 1e-120 | truncated transcription factor CAULIFLOWER A-like isoform X1 | ||||
Swissprot | Q42429 | 1e-111 | AGL8_SOLTU; Agamous-like MADS-box protein AGL8 homolog | ||||
TrEMBL | A0A1S3YGF6 | 1e-119 | A0A1S3YGF6_TOBAC; agamous-like MADS-box protein AGL8 homolog | ||||
TrEMBL | Q283Q1 | 1e-119 | Q283Q1_MALDO; MdMads2.1 protein | ||||
STRING | Lus10007983 | 0.0 | (Linum usitatissimum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF588 | 32 | 119 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G60910.1 | 1e-100 | AGAMOUS-like 8 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Lus10007983 |
Publications ? help Back to Top | |||
---|---|---|---|
|