PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Lus10005917 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 57aa MW: 6385.61 Da PI: 9.9265 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 40.2 | 1e-12 | 14 | 56 | 1 | 44 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykveP 44 lpp frFhPt+eelvv+yLk+kv + +l++ ++i+ev+i k++P Lus10005917 14 LPPSFRFHPTNEELVVQYLKRKVCSFPLPA-SIIPEVNISKSDP 56 79****************************.89*********99 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 7.85E-15 | 4 | 56 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 17.508 | 14 | 56 | IPR003441 | NAC domain |
Pfam | PF02365 | 1.2E-6 | 15 | 37 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 57 aa Download sequence Send to blast |
MEKMSCVKKG VLRLPPSFRF HPTNEELVVQ YLKRKVCSFP LPASIIPEVN ISKSDP* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional repressor that negatively regulates the expression of genes involved in xylem vessel formation. Represses the transcriptional activation activity of NAC030/VND7, which regulates protoxylem vessel differentiation by promoting immature xylem vessel-specific genes expression (PubMed:20388856). Transcriptional activator that regulates the COLD-REGULATED (COR15A and COR15B) and RESPONSIVE TO DEHYDRATION (LTI78/RD29A and LTI65/RD29B) genes by binding directly to their promoters. Mediates signaling crosstalk between salt stress response and leaf aging process (PubMed:21673078). May play a role in DNA replication of mungbean yellow mosaic virus (PubMed:24442717). {ECO:0000269|PubMed:20388856, ECO:0000269|PubMed:21673078, ECO:0000269|PubMed:24442717}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Lus10005917 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By abscisic acid (ABA) and salt stress. {ECO:0000269|PubMed:21673078}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_016436915.1 | 8e-25 | PREDICTED: NAC domain-containing protein 83-like | ||||
Refseq | XP_018623368.1 | 8e-25 | PREDICTED: NAC domain-containing protein 83-like | ||||
Swissprot | Q9FY93 | 2e-23 | NAC83_ARATH; NAC domain-containing protein 83 | ||||
TrEMBL | A0A1S3XAF5 | 2e-23 | A0A1S3XAF5_TOBAC; NAC domain-containing protein 83-like | ||||
STRING | Lus10005917 | 3e-33 | (Linum usitatissimum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF21137 | 4 | 4 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G13180.1 | 7e-26 | NAC domain containing protein 83 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Lus10005917 |
Publications ? help Back to Top | |||
---|---|---|---|
|