PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10005917
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family NAC
Protein Properties Length: 57aa    MW: 6385.61 Da    PI: 9.9265
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10005917genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM40.21e-121456144
          NAM  1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykveP 44
                 lpp frFhPt+eelvv+yLk+kv + +l++ ++i+ev+i k++P
  Lus10005917 14 LPPSFRFHPTNEELVVQYLKRKVCSFPLPA-SIIPEVNISKSDP 56
                 79****************************.89*********99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019417.85E-15456IPR003441NAC domain
PROSITE profilePS5100517.5081456IPR003441NAC domain
PfamPF023651.2E-61537IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 57 aa     Download sequence    Send to blast
MEKMSCVKKG VLRLPPSFRF HPTNEELVVQ YLKRKVCSFP LPASIIPEVN ISKSDP*
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional repressor that negatively regulates the expression of genes involved in xylem vessel formation. Represses the transcriptional activation activity of NAC030/VND7, which regulates protoxylem vessel differentiation by promoting immature xylem vessel-specific genes expression (PubMed:20388856). Transcriptional activator that regulates the COLD-REGULATED (COR15A and COR15B) and RESPONSIVE TO DEHYDRATION (LTI78/RD29A and LTI65/RD29B) genes by binding directly to their promoters. Mediates signaling crosstalk between salt stress response and leaf aging process (PubMed:21673078). May play a role in DNA replication of mungbean yellow mosaic virus (PubMed:24442717). {ECO:0000269|PubMed:20388856, ECO:0000269|PubMed:21673078, ECO:0000269|PubMed:24442717}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLus10005917
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By abscisic acid (ABA) and salt stress. {ECO:0000269|PubMed:21673078}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016436915.18e-25PREDICTED: NAC domain-containing protein 83-like
RefseqXP_018623368.18e-25PREDICTED: NAC domain-containing protein 83-like
SwissprotQ9FY932e-23NAC83_ARATH; NAC domain-containing protein 83
TrEMBLA0A1S3XAF52e-23A0A1S3XAF5_TOBAC; NAC domain-containing protein 83-like
STRINGLus100059173e-33(Linum usitatissimum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF2113744
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13180.17e-26NAC domain containing protein 83
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]